LINC00588 (long intergenic non-protein coding RNA 588)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 26138
Gene name Long intergenic non-protein coding RNA 588
Gene symbol LINC00588
Synonyms (NCBI Gene)
C8orf71
Chromosome 8
Chromosome location 8q12.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Gene Gene ontology Other IDs Protein
Show/Hide all (1)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
HGNC 24494 N/A
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y4M8
Protein name Putative uncharacterized protein encoded by LINC00588
Family and domains
Sequence 
MATFHRAHATSSVKPRARRHQEPNSGDWPGSYRAGTRCSAIGFRLLHSPQHWRPRSLGAG
QGREDPSWEGGALGDLKALWDQPCQPPPWVQLQLSSAYGARQQRWQLSTLPEPPAARTPG
QMPQQRLIRAAGPSAAGGGNQWLSPM
Sequence length 146
Interactions View interactions