Gene Gene information from NCBI Gene database.
Entrez ID 26112
Gene name Coiled-coil domain containing 69
Gene symbol CCDC69
Synonyms (NCBI Gene)
-
Chromosome 5
Chromosome location 5q33.1
miRNA miRNA information provided by mirtarbase database.
312
miRTarBase ID miRNA Experiments Reference
MIRT018220 hsa-miR-335-5p Microarray 18185580
MIRT646681 hsa-miR-892a HITS-CLIP 23824327
MIRT646680 hsa-miR-6858-3p HITS-CLIP 23824327
MIRT646679 hsa-miR-4676-5p HITS-CLIP 23824327
MIRT646678 hsa-miR-575 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005819 Component Spindle IEA
GO:0005856 Component Cytoskeleton IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619288 24487 ENSG00000198624
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NI79
Protein name Coiled-coil domain-containing protein 69
Protein function May act as a scaffold to regulate the recruitment and assembly of spindle midzone components. Required for the localization of AURKB and PLK1 to the spindle midzone.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in duodenum, esophagus, pancreas, prostate, salivary gland, thymus and urinary bladder. {ECO:0000269|PubMed:20962590}.
Sequence
MGCRHSRLSSCKPPKKKRQEPEPEQPPRPEPHELGPLNGDTAITVQLCASEEAERHQKDI
TRILQQHEEEKKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRASYEQEKEALT
HSFREASSTQQETIDRLTSQLEAFQAKMKRVEESILSRNYKKHIQDYGSPSQFWEQELES
LHFVIEMKNERIHELDRRLILMETVKEKNLILEEKITTLQQENEDLHVRSRNQVVLSRQL
SEDLLLTREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT
Sequence length 296
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Uncertain significance rs148835102 RCV005926927
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 33634680
Breast Neoplasms Inhibit 37828454
Colorectal Neoplasms Associate 32859214
Glomerulonephritis IGA Associate 36793719
Neoplasms Associate 31881847, 37828454
Ovarian Neoplasms Associate 30651135
Periodontitis Associate 36793719
Triple Negative Breast Neoplasms Inhibit 33634680