Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26112
Gene name Gene Name - the full gene name approved by the HGNC.
Coiled-coil domain containing 69
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCDC69
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q33.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018220 hsa-miR-335-5p Microarray 18185580
MIRT646681 hsa-miR-892a HITS-CLIP 23824327
MIRT646680 hsa-miR-6858-3p HITS-CLIP 23824327
MIRT646679 hsa-miR-4676-5p HITS-CLIP 23824327
MIRT646678 hsa-miR-575 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005819 Component Spindle IEA
GO:0005856 Component Cytoskeleton IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619288 24487 ENSG00000198624
Protein
UniProt ID A6NI79
Protein name Coiled-coil domain-containing protein 69
Protein function May act as a scaffold to regulate the recruitment and assembly of spindle midzone components. Required for the localization of AURKB and PLK1 to the spindle midzone.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in duodenum, esophagus, pancreas, prostate, salivary gland, thymus and urinary bladder. {ECO:0000269|PubMed:20962590}.
Sequence
MGCRHSRLSSCKPPKKKRQEPEPEQPPRPEPHELGPLNGDTAITVQLCASEEAERHQKDI
TRILQQHEEEKKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRASYEQEKEALT
HSFREASSTQQETIDRLTSQLEAFQAKMKRVEESILSRNYKKHIQDYGSPSQFWEQELES
LHFVIEMKNERIHELDRRLILMETVKEKNLILEEKITTLQQENEDLHVRSRNQVVLSRQL
SEDLLLTREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT
Sequence length 296
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bulimia Bulimia nervosa N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 33634680
Breast Neoplasms Inhibit 37828454
Colorectal Neoplasms Associate 32859214
Glomerulonephritis IGA Associate 36793719
Neoplasms Associate 31881847, 37828454
Ovarian Neoplasms Associate 30651135
Periodontitis Associate 36793719
Triple Negative Breast Neoplasms Inhibit 33634680