Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	26086
Gene name Gene Name - the full gene name approved by the HGNC.	G protein signaling modulator 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPSM1
Synonyms (NCBI Gene) Gene synonyms aliases	AGS3
Disease Acronyms (UniProt) Disease acronyms from UniProt database	AGS3
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q34.3
Summary Summary of gene provided in NCBI Entrez Gene.	G-protein signaling modulators (GPSMs) play diverse functional roles through their interaction with G-protein subunits. This gene encodes a receptor-independent activator of G protein signaling, which is one of several factors that influence the basal act

Show/Hide all(53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039937	hsa-miR-615-3p	CLASH	23622248
MIRT1032372	hsa-miR-1266	CLIP-seq
MIRT1032373	hsa-miR-1307	CLIP-seq
MIRT1032374	hsa-miR-1908	CLIP-seq
MIRT1032375	hsa-miR-3127-5p	CLIP-seq
MIRT1032376	hsa-miR-3918	CLIP-seq
MIRT1032377	hsa-miR-4446-3p	CLIP-seq
MIRT1032378	hsa-miR-4518	CLIP-seq
MIRT1032379	hsa-miR-663	CLIP-seq
MIRT1032380	hsa-miR-3940-5p	CLIP-seq
MIRT1032381	hsa-miR-3978	CLIP-seq
MIRT1032382	hsa-miR-4507	CLIP-seq
MIRT1032383	hsa-miR-635	CLIP-seq
MIRT1032384	hsa-miR-711	CLIP-seq
MIRT1032385	hsa-miR-1275	CLIP-seq
MIRT1032386	hsa-miR-3122	CLIP-seq
MIRT1032387	hsa-miR-3130-3p	CLIP-seq
MIRT1032388	hsa-miR-3689a-3p	CLIP-seq
MIRT1032389	hsa-miR-3689c	CLIP-seq
MIRT1032390	hsa-miR-3913-5p	CLIP-seq
MIRT1032391	hsa-miR-4290	CLIP-seq
MIRT1032392	hsa-miR-4447	CLIP-seq
MIRT1032393	hsa-miR-4472	CLIP-seq
MIRT1032394	hsa-miR-4481	CLIP-seq
MIRT1032395	hsa-miR-4525	CLIP-seq
MIRT1032396	hsa-miR-4643	CLIP-seq
MIRT1032397	hsa-miR-4665-5p	CLIP-seq
MIRT1032398	hsa-miR-4687-5p	CLIP-seq
MIRT1032399	hsa-miR-4717-3p	CLIP-seq
MIRT1032400	hsa-miR-4721	CLIP-seq
MIRT1032401	hsa-miR-4723-5p	CLIP-seq
MIRT1032402	hsa-miR-4745-5p	CLIP-seq
MIRT1032403	hsa-miR-625	CLIP-seq
MIRT1032404	hsa-miR-642b	CLIP-seq
MIRT2006259	hsa-miR-214	CLIP-seq
MIRT2006260	hsa-miR-3619-5p	CLIP-seq
MIRT2006261	hsa-miR-761	CLIP-seq
MIRT2388688	hsa-miR-1291	CLIP-seq
MIRT2542618	hsa-miR-1297	CLIP-seq
MIRT2542619	hsa-miR-181a	CLIP-seq
MIRT2542620	hsa-miR-181b	CLIP-seq
MIRT2542621	hsa-miR-181c	CLIP-seq
MIRT2542622	hsa-miR-181d	CLIP-seq
MIRT2542623	hsa-miR-26a	CLIP-seq
MIRT2542624	hsa-miR-26b	CLIP-seq
MIRT2542625	hsa-miR-3942-5p	CLIP-seq
MIRT2542626	hsa-miR-4262	CLIP-seq
MIRT2542627	hsa-miR-4465	CLIP-seq
MIRT2542628	hsa-miR-4703-5p	CLIP-seq
MIRT2542629	hsa-miR-4706	CLIP-seq
MIRT2542630	hsa-miR-4749-5p	CLIP-seq
MIRT2542631	hsa-miR-521	CLIP-seq
MIRT2542632	hsa-miR-744	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	12642577
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	11024022
GO:0005515	Function	Protein binding	IPI	16458856, 18566450, 22074847
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	12642577
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	18566450
GO:0005938	Component	Cell cortex	IDA	18566450
GO:0007399	Process	Nervous system development	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IDA	12642577
GO:0030154	Process	Cell differentiation	IEA
GO:0032991	Component	Protein-containing complex	IDA	16458856, 22074847
GO:0034260	Process	Negative regulation of GTPase activity	IDA	11024022
GO:1905098	Process	Negative regulation of guanyl-nucleotide exchange factor activity	IDA	11024022

MIM	HGNC	e!Ensembl
609491	17858	ENSG00000160360

Protein

UniProt ID

Q86YR5

Protein name

G-protein-signaling modulator 1 (Activator of G-protein signaling 3)

Protein function

Guanine nucleotide dissociation inhibitor (GDI) which functions as a receptor-independent activator of heterotrimeric G-protein signaling. Keeps G(i/o) alpha subunit in its GDP-bound form thus uncoupling heterotrimeric G-proteins signaling from

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13424	TPR_12	104 → 163		Repeat
PF13424	TPR_12	187 → 241		Repeat
PF13424	TPR_12	208 → 281		Repeat
PF13424	TPR_12	247 → 321		Repeat
PF13424	TPR_12	285 → 361		Repeat
PF02188	GoLoco	496 → 517	GoLoco motif	Motif
PF02188	GoLoco	549 → 569	GoLoco motif	Motif
PF02188	GoLoco	597 → 618	GoLoco motif	Motif
PF02188	GoLoco	631 → 652	GoLoco motif	Motif

Tissue specificity

TISSUE SPECIFICITY: Expressed in intestinal cells. {ECO:0000269|PubMed:12642577}.

Sequence

MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTE
DLKTLSAIYSQLGNAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLG
RFDEAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPD
VRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAK
EFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSRQLRDQAVEAQACYSLGNTYT
LLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQ
EIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSAETWDLL
RLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRV
HVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQP
SMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFF
NMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGA
GGPPEPQQQCQPGAS

Sequence length

675

Interactions

View interactions

	KEGG		Reactome
	Cocaine addiction		G alpha (i) signalling events

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	29632382, 23945395, 28869590, 30595370, 30718926, 31118516, 26818947

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Source
Unknown
Diabetes	Diabetes	GWAS
Ankylosing Spondylitis	Ankylosing Spondylitis	GWAS
Myocardial Infarction	Myocardial Infarction	GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease	GWAS
Coronary artery disease	Coronary artery disease	GWAS
Ulcerative colitis	Ulcerative colitis	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Colorectal Neoplasms	Associate	12642577, 25774687
Diabetes Gestational	Associate	29947923
Leukemia Biphenotypic Acute	Associate	34257610
Neoplasms	Associate	25740824, 34257610, 36609218
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	34257610
Thyroid Cancer Papillary	Associate	36609218
Thyroid Carcinoma Anaplastic	Associate	36609218

GPSM1 (G protein signaling modulator 1)