Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26086
Gene name Gene Name - the full gene name approved by the HGNC.
G protein signaling modulator 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPSM1
Synonyms (NCBI Gene) Gene synonyms aliases
AGS3
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.3
Summary Summary of gene provided in NCBI Entrez Gene.
G-protein signaling modulators (GPSMs) play diverse functional roles through their interaction with G-protein subunits. This gene encodes a receptor-independent activator of G protein signaling, which is one of several factors that influence the basal act
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT039937 hsa-miR-615-3p CLASH 23622248
MIRT1032372 hsa-miR-1266 CLIP-seq
MIRT1032373 hsa-miR-1307 CLIP-seq
MIRT1032374 hsa-miR-1908 CLIP-seq
MIRT1032375 hsa-miR-3127-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000132 Process Establishment of mitotic spindle orientation IBA
GO:0000139 Component Golgi membrane IDA 12642577
GO:0000139 Component Golgi membrane IEA
GO:0001965 Function G-protein alpha-subunit binding IBA
GO:0005092 Function GDP-dissociation inhibitor activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609491 17858 ENSG00000160360
Protein
UniProt ID Q86YR5
Protein name G-protein-signaling modulator 1 (Activator of G-protein signaling 3)
Protein function Guanine nucleotide dissociation inhibitor (GDI) which functions as a receptor-independent activator of heterotrimeric G-protein signaling. Keeps G(i/o) alpha subunit in its GDP-bound form thus uncoupling heterotrimeric G-proteins signaling from
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13424 TPR_12 104 163 Repeat
PF13424 TPR_12 187 241 Repeat
PF13424 TPR_12 208 281 Repeat
PF13424 TPR_12 247 321 Repeat
PF13424 TPR_12 285 361 Repeat
PF02188 GoLoco 496 517 GoLoco motif Motif
PF02188 GoLoco 549 569 GoLoco motif Motif
PF02188 GoLoco 597 618 GoLoco motif Motif
PF02188 GoLoco 631 652 GoLoco motif Motif
Tissue specificity TISSUE SPECIFICITY: Expressed in intestinal cells. {ECO:0000269|PubMed:12642577}.
Sequence
MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTE
DLKTLSAIYSQLGNAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLG
RFDEAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQL
SWNAANATQDPGHLPPD
VRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAK
E
FGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSRQLRDQAVEAQACYSLGNTYT
LLQDYERAAEYHLRHLLIAQE
LADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQ
E
IGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSAETWDLL
RLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRV
HVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQP
SMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFF
NMLIKYQSSRIDDQRCPP
PDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGA
GGPPEPQQQCQPGAS
Sequence length 675
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cocaine addiction   G alpha (i) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ankylosing Spondylitis Ankylosing spondylitis N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Type 2 diabetes (adjusted for BMI), Type 2 diabetes with renal manifestations (PheCode 250.22), Type 2 diabetes with ophthalmic manifestations (PheCode 250.23), Type 2 diabetes (PheCode 250.2), Type 2 diabetes mellitus or coronary artery disease (pleiotropy), Type 2 diabetes mellitus adjusted for BMI or coronary artery disease (pleiotropy), Type 2 diabetes N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease (MTAG) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colorectal Neoplasms Associate 12642577, 25774687
Diabetes Gestational Associate 29947923
Leukemia Biphenotypic Acute Associate 34257610
Neoplasms Associate 25740824, 34257610, 36609218
Precursor Cell Lymphoblastic Leukemia Lymphoma Associate 34257610
Thyroid Cancer Papillary Associate 36609218
Thyroid Carcinoma Anaplastic Associate 36609218