Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26053
Gene name Gene Name - the full gene name approved by the HGNC.
Activator of transcription and developmental regulator AUTS2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AUTS2
Synonyms (NCBI Gene) Gene synonyms aliases
FBRSL2, MRD26
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q11.22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene has been implicated in neurodevelopment and as a candidate gene for numerous neurological disorders, including autism spectrum disorders, intellectual disability, and developmental delay. Mutations in this gene have also been associated with non
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs767529359 C>A,T Uncertain-significance, likely-pathogenic 5 prime UTR variant, coding sequence variant, genic downstream transcript variant, missense variant
rs775225727 C>A,G,T Likely-pathogenic Coding sequence variant, stop gained, genic upstream transcript variant, missense variant
rs864321694 AA>- Pathogenic Genic downstream transcript variant, frameshift variant, upstream transcript variant, coding sequence variant, genic upstream transcript variant
rs869312878 ->C Likely-pathogenic Coding sequence variant, genic downstream transcript variant, frameshift variant
rs886041609 G>A Pathogenic Stop gained, genic downstream transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030951 hsa-miR-21-5p Microarray 19253296
MIRT046611 hsa-miR-222-3p CLASH 23622248
MIRT441135 hsa-miR-218-5p HITS-CLIP 23212916
MIRT441135 hsa-miR-218-5p HITS-CLIP 23212916
MIRT812212 hsa-miR-3653 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001764 Process Neuron migration ISS
GO:0003682 Function Chromatin binding IDA 25519132
GO:0005515 Function Protein binding IPI 25519132, 27705803, 28514442, 32296183, 33961781, 34637754
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607270 14262 ENSG00000158321
Protein
UniProt ID Q8WXX7
Protein name Autism susceptibility gene 2 protein
Protein function Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remod
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15336 Auts2 645 857 Autism susceptibility gene 2 protein Family
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in brain, skeletal muscle and kidney. Also expressed in placenta, lung and leukocytes. {ECO:0000269|PubMed:12160723, ECO:0000269|PubMed:23332918}.
Sequence
MDGPTRGHGLRKKRRSRSQRDRERRSRGGLGAGAAGGGGAGRTRALSLASSSGSDKEDNG
KPPSSAPSRPRPPRRKRRESTSAEEDIIDGFAMTSFVTFEALEKDVALKPQERVEKRQTP
LTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQLKPGQN
SCRDSDSESASGESKGFHRSSSRERLSDSSAPSSLGTGYFCDSDSDQEEKASDASSEKLF
NTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDPCP
QVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQR
PPRPQSPTQLLHQNLPPVQAHPSAQSLSQPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPP
HISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQVA
GHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQ
HTFTPFPHAIPPTAIMPTPAPPMFDKYPTKVDPFYRHSLFHSYPPAVSGIPPMIPPTGPF
GSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAWQI
YHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHP
TGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDG
PSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKD
DKERESVEKRHSSHPSP
APVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSES
RKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESARPNSTSSR
EAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLA
SMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYR
ELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHHHPLSVDPR
REHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHYPRISPT
AGNQNGLLNKTPPTAALSAPPPLISTLGGRPVSPRRTTPLSAEIRERPPSHTLKDIEAR
Sequence length 1259
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Polycomb repressive complex   RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Autism Spectrum Disorder autism spectrum disorder due to auts2 deficiency rs1554464807, rs1554401434, rs1563183492, rs864321694, rs869312878, rs1562957809, rs1057518198, rs1585645641, rs1585667374, rs1057517708, rs1585653028, rs1585653240, rs1554480537, rs1585645384, rs1554481395
View all (1 more)
N/A
Mental retardation Intellectual disability, autosomal dominant 57, intellectual disability rs1562957809, rs1057517708 N/A
Pierre-Robin Syndrome Pierre Robin-like syndrome rs1057518986 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
15q11q13 microduplication syndrome 15q11q13 microduplication syndrome N/A N/A ClinVar
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Breast Cancer Breast cancer specific mortality in estrogen receptor positive breast cancer N/A N/A GWAS
Diabetes Type 2 diabetes with ophthalmic manifestations (PheCode 250.23), Type 2 diabetes (PheCode 250.2), Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 22521361
Agenesis of Corpus Callosum Associate 33562463
Apraxias Associate 40419990
Arthrogryposis Associate 39953909
Atrioventricular Septal Defect Associate 27396555
Attention Deficit Disorder with Hyperactivity Associate 19546859
Autism Spectrum Disorder Associate 22872102, 36864756
Autistic Disorder Associate 19546859, 22521361, 23575222, 24265791, 24776741, 25205402, 25347278, 30190612, 31505389, 37948839, 39953909
Autoimmune Diseases Associate 19727120
Autosomal Recessive Primary Microcephaly Associate 35802027