Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26051
Gene name Gene Name - the full gene name approved by the HGNC.
Protein phosphatase 1 regulatory subunit 16B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PPP1R16B
Synonyms (NCBI Gene) Gene synonyms aliases
ANKRD4, TIMAP
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is membrane-associated and contains five ankyrin repeats, a protein phosphatase-1-interacting domain, and a carboxy-terminal CAAX box domain. Synthesis of the encoded protein is inhibited by transforming growth factor beta
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052173 hsa-let-7b-5p CLASH 23622248
MIRT711119 hsa-miR-34a-3p HITS-CLIP 19536157
MIRT711118 hsa-miR-3614-3p HITS-CLIP 19536157
MIRT711117 hsa-miR-1207-3p HITS-CLIP 19536157
MIRT711115 hsa-miR-6849-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001938 Process Positive regulation of endothelial cell proliferation IMP 25007873
GO:0004857 Function Enzyme inhibitor activity IBA
GO:0005515 Function Protein binding IPI 16263087, 18586956, 25007873, 25416956, 26497934, 27107012, 28330616, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IDA 12055102, 18586956
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613275 15850 ENSG00000101445
Protein
UniProt ID Q96T49
Protein name Protein phosphatase 1 regulatory inhibitor subunit 16B (Ankyrin repeat domain-containing protein 4) (CAAX box protein TIMAP) (TGF-beta-inhibited membrane-associated protein) (hTIMAP)
Protein function Regulator of protein phosphatase 1 (PP1) that acts as a positive regulator of pulmonary endothelial cell (EC) barrier function (PubMed:18586956). Involved in the regulation of the PI3K/AKT signaling pathway, angiogenesis and endothelial cell pro
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 72 164 Ankyrin repeats (3 copies) Repeat
PF00023 Ank 261 293 Ankyrin repeat Repeat
Sequence
MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGR
RKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLL
LSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVN
SDGNMPYDLCEDEPTL
DVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWIDAQGATLLHIAGANG
YLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPID
LCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRASLSDRTNLYRK
EYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPRGEL
DMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTL
LELKRQRAAAKLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVT
SGDPPLLKFKAPIEEMEEKVHGCCRIS
Sequence length 567
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 34181349
Colorectal Neoplasms Associate 28058013
Hepatitis B Associate 34181349
Neoplasms Associate 32407802
Triple Negative Breast Neoplasms Associate 34181349