CYP4X1 (cytochrome P450 family 4 subfamily X member 1)

Gene

• Entrez ID: 260293
• Gene name: Cytochrome P450 family 4 subfamily X member 1
• Gene symbol: CYP4X1
• Synonyms (NCBI Gene): CYPIVX1
• Chromosome: 1
• Chromosome location: 1p33|1
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes and is located within a cluster of genes belonging to this superfamily on chromosome 1. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2208738	hsa-miR-4766-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0020037	Function	Heme binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0062189	Function	Anandamide 14,15 epoxidase activity	IDA	18549450
GO:0062189	Function	Anandamide 14,15 epoxidase activity	IEA

Other IDs

• MIM: 614999
• HGNC: 20244
• e!Ensembl: ENSG00000186377

Protein

• UniProt ID: Q8N118
• Protein name: Cytochrome P450 4X1 (EC 1.14.14.-) (CYPIVX1)
• Protein function: A cytochrome P450 monooxygenase that selectively catalyzes the epoxidation of the last double bond of the arachidonoyl moiety of anandamide, potentially modulating endocannabinoid signaling. Has no hydroxylase activity toward various fatty acids
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	46 → 502	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, heart, kidney and skin and, at lower levels, in skeletal muscle and liver (PubMed:16478468, PubMed:18549450). In the brain, high levels are detected in amygdala and lower levels in globus pallidus and cerebellum (Pu
• Sequence:

  MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKF
  IQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPL
  LGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEV
  YEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKL
  SPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSS
  FSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQ
  LGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVW
  KNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD
  PTRPLTFPNHFILKPKNGMYLHLKKLSEC

• Sequence length: 509

Pathways

KEGG:

Serotonergic synapse

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	33802237	★☆☆☆☆ Found in Text Mining only
Creutzfeldt Jakob Syndrome	Associate	30755683	★☆☆☆☆ Found in Text Mining only
Hypospadias	Associate	32728162	★☆☆☆☆ Found in Text Mining only