Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26022
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 98
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM98
Synonyms (NCBI Gene) Gene synonyms aliases
TADA1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777690 G>C,T Pathogenic Coding sequence variant, missense variant
rs869312733 A>C Pathogenic Missense variant, coding sequence variant
rs869312734 AGAATGAAGACTGGATCGAAGATGCCTCGTAAGG>- Pathogenic Coding sequence variant, splice donor variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT044487 hsa-miR-320a CLASH 23622248
MIRT044487 hsa-miR-320a CLASH 23622248
MIRT043661 hsa-miR-342-3p CLASH 23622248
MIRT042183 hsa-miR-484 CLASH 23622248
MIRT344723 hsa-miR-577 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IDA 25946230
GO:0005615 Component Extracellular space IEA
GO:0005783 Component Endoplasmic reticulum IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615949 24529 ENSG00000006042
Protein
UniProt ID Q9Y2Y6
Protein name Transmembrane protein 98 (Protein TADA1)
Protein function Functions as a negative regulator of MYRF in oligodendrocyte differentiation and myelination. Interacts with the C-terminal of MYRF inhibiting MYRF self-cleavage and N-fragment nuclear translocation. The secreted form promotes differentiation of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13324 GCIP 41 170 Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high expression in the ovary, pancreas and prostate (PubMed:25946230). Expressed in the eye, particularly in corneal endothelium, iris, ciliary body, sclera, optic nerve, optic nerve head, and retina (PubMed:24852
Sequence
METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPS
ELELDDVVITNPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMK
TSASVSDIIVVAKRISPRVDDVVKSMYPPLDPKLLDARTTALLLSVSHLV
LVTRNACHLT
GGLDWIDQSLSAAEEHLEVLREAALASEPDKGLPGPEGFLQEQSAI
Sequence length 226
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Nanophthalmos nanophthalmos 4 rs587777690, rs869312733, rs869312734 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Myopia Myopia N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 20855955
Aicardi Goutieres syndrome Associate 32996714
Carcinoma Non Small Cell Lung Associate 26884835
Hyperopia Associate 33203948
Lung Neoplasms Inhibit 26884835
Microphthalmos Associate 32052405
Nanophthalmos 1 Associate 26392740, 32052405, 33004036, 33203948
Neoplasms Inhibit 35866395
Ovarian Neoplasms Inhibit 35866395