AOC1 (amine oxidase copper containing 1)

Gene

• Entrez ID: 26
• Gene name: Amine oxidase copper containing 1
• Gene symbol: AOC1
• Synonyms (NCBI Gene): ABP, ABP1, DAO, DAO1, KAO, KDAO
• Chromosome: 7
• Chromosome location: 7q36.1
• Summary: This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005507	Function	Copper ion binding	IBA
GO:0005507	Function	Copper ion binding	IDA	12072962, 19764817
GO:0005507	Function	Copper ion binding	IEA
GO:0005509	Function	Calcium ion binding	IDA	12072962, 19764817
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	8144586
GO:0005615	Component	Extracellular space	IDA	9399025, 12072962
GO:0005777	Component	Peroxisome	NAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	2217167, 8144586
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005923	Component	Bicellular tight junction	ISS
GO:0008131	Function	Primary methylamine oxidase activity	IBA
GO:0008131	Function	Primary methylamine oxidase activity	IDA	8144586
GO:0008131	Function	Primary methylamine oxidase activity	IEA
GO:0008201	Function	Heparin binding	IDA	19764817
GO:0008201	Function	Heparin binding	IEA
GO:0009308	Process	Amine metabolic process	IEA
GO:0009445	Process	Putrescine metabolic process	IBA
GO:0009445	Process	Putrescine metabolic process	IMP	8144586
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0042803	Function	Protein homodimerization activity	IPI	19764817
GO:0046872	Function	Metal ion binding	IEA
GO:0048038	Function	Quinone binding	IEA
GO:0050232	Function	Putrescine oxidase activity	IDA	7626074, 12072962, 19764817
GO:0050232	Function	Putrescine oxidase activity	IEA
GO:0052597	Function	Diamine oxidase activity	IBA
GO:0052597	Function	Diamine oxidase activity	IDA	8144586, 9399025, 12072962, 16846222
GO:0052598	Function	Histamine oxidase activity	IDA	12072962
GO:0052598	Function	Histamine oxidase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070062	Component	Extracellular exosome	IDA	21082674

Other IDs

• MIM: 104610
• HGNC: 80
• e!Ensembl: ENSG00000002726

Protein

• UniProt ID: P19801
• Protein name: Diamine oxidase [copper-containing] (Diamine oxidase) (EC 1.4.3.22) (Amiloride-binding protein) (Amiloride-binding protein 1) (Amine oxidase copper domain-containing protein 1) (Histaminase) (Kidney amine oxidase) (KAO) (KDAO)
• Protein function: Catalyzes the oxidative deamination of primary amines to the corresponding aldehydes with the concomitant production of hydrogen peroxide and ammonia (PubMed:12072962, PubMed:19764817, PubMed:239684, PubMed:8144586). Its preferred substrates are
• PDB: 3HI7, 3HIG, 3HII, 3K5T, 3MPH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02727	Cu_amine_oxidN2	39 → 125	Copper amine oxidase, N2 domain	Domain
  PF02728	Cu_amine_oxidN3	141 → 241	Copper amine oxidase, N3 domain	Domain
  PF01179	Cu_amine_oxid	300 → 712	Copper amine oxidase, enzyme domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with higher expression in placenta and kidney. {ECO:0000269|PubMed:12072962}.
• Sequence:

  MPALGWAVAAILMLQTAMAEPSPGTLPRKAGVFSDLSNQELKAVHSFLWSKKELRLQPSS
  TTTMAKNTVFLIEMLLPKKYHVLRFLDKGERHPVREARAVIFFGDQEHPNVTEFAVGPLP
  GPCYMRALSPRPGYQSSWASRPISTAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR
  CLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWAVEQVWYNG
  KFYGSPEELARKYADGEVDVVVLEDPLPGGKGHDSTEEPPLFSSHKPRGDFPSPIHVSGP
  RLVQPHGPRFRLEGNAVLYGGWSFAFRLRSSSGLQVLNVHFGGERIAYEVSVQEAVALYG
  GHTPAGMQTKYLDVGWGLGSVTHELAPGIDCPETATFLDTFHYYDADDPVHYPRALCLFE
  MPTGVPLRRHFNSNFKGGFNFYAGLKGQVLVLRTTSTVYNYDYIWDFIFYPNGVMEAKMH
  ATGYVHATFYTPEGLRHGTRLHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENIT
  NPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRTYRLQIHSM
  ADQVLPPGWQEEQAITWARYPLAVTKYRESELCSSSIYHQNDPWHPPVVFEQFLHNNENI
  ENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNFFPEDPSLASRDTVIVWPRD
  NGPNYVQRWIPEDRDCSMPPPFSYNGTYRPV

• Sequence length: 751

Pathways

KEGG:

Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
Metabolic pathways

Reactome:

Phase I - Functionalization of compounds
Neutrophil degranulation