Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2596
Gene name Gene Name - the full gene name approved by the HGNC.	Growth associated protein 43
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GAP43
Synonyms (NCBI Gene) Gene synonyms aliases	B-50, GAP-43, PP46
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q13.31
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene has been termed a `growth` or `plasticity` protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective

Show/Hide all(72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT489932	hsa-miR-890	PAR-CLIP	23592263
MIRT489931	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT489930	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT489929	hsa-miR-3125	PAR-CLIP	23592263
MIRT489928	hsa-miR-3916	PAR-CLIP	23592263
MIRT489927	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT489926	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT735583	hsa-miR-17-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32095982
MIRT489932	hsa-miR-890	PAR-CLIP	23592263
MIRT489931	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT489930	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT489929	hsa-miR-3125	PAR-CLIP	23592263
MIRT489928	hsa-miR-3916	PAR-CLIP	23592263
MIRT489927	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT489926	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT1011993	hsa-miR-1293	CLIP-seq
MIRT1011994	hsa-miR-3153	CLIP-seq
MIRT1011995	hsa-miR-4483	CLIP-seq
MIRT1011996	hsa-miR-4668-5p	CLIP-seq
MIRT1011997	hsa-miR-4727-3p	CLIP-seq
MIRT1011998	hsa-miR-3202	CLIP-seq
MIRT1011999	hsa-miR-4475	CLIP-seq
MIRT1012000	hsa-miR-4476	CLIP-seq
MIRT1012001	hsa-miR-4796-3p	CLIP-seq
MIRT1012002	hsa-miR-759	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq
MIRT2537045	hsa-miR-1261	CLIP-seq
MIRT2537046	hsa-miR-130a	CLIP-seq
MIRT2537047	hsa-miR-130b	CLIP-seq
MIRT2537048	hsa-miR-148a	CLIP-seq
MIRT2537049	hsa-miR-148b	CLIP-seq
MIRT2537050	hsa-miR-152	CLIP-seq
MIRT2537051	hsa-miR-188-3p	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT2537052	hsa-miR-301a	CLIP-seq
MIRT2537053	hsa-miR-301b	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT2537054	hsa-miR-3666	CLIP-seq
MIRT2537055	hsa-miR-3671	CLIP-seq
MIRT2537056	hsa-miR-3918	CLIP-seq
MIRT2537057	hsa-miR-4295	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT2537058	hsa-miR-454	CLIP-seq
MIRT2537059	hsa-miR-4696	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9139733, 25893612, 30664241, 32814053
GO:0005516	Function	Calmodulin binding	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0007205	Process	Protein kinase C-activating G protein-coupled receptor signaling pathway	TAS	3272162
GO:0009611	Process	Response to wounding	TAS	3272162
GO:0010001	Process	Glial cell differentiation	IEA
GO:0014069	Component	Postsynaptic density	IBA	21873635
GO:0016198	Process	Axon choice point recognition	IBA	21873635
GO:0030425	Component	Dendrite	IEA
GO:0031103	Process	Axon regeneration	IBA	21873635
GO:0031527	Component	Filopodium membrane	IDA	14978216
GO:0032584	Component	Growth cone membrane	IEA
GO:0035727	Function	Lysophosphatidic acid binding	IBA	21873635
GO:0040008	Process	Regulation of growth	IEA
GO:0042246	Process	Tissue regeneration	IBA	21873635
GO:0043204	Component	Perikaryon	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0051489	Process	Regulation of filopodium assembly	IDA	14978216
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099150	Process	Regulation of postsynaptic specialization assembly	IEA
GO:1901981	Function	Phosphatidylinositol phosphate binding	IBA	21873635

MIM	HGNC	e!Ensembl
162060	4140	ENSG00000172020

Protein

UniProt ID

P17677

Protein name

Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)

Protein function

This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction. {ECO:0000269|PubMed:14978216, ECO:0000269|PubMed

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10580	Neuromodulin_N	2 → 31	Gap junction protein N-terminal region	Domain
PF00612	IQ	32 → 52	IQ calmodulin-binding motif	Motif
PF06614	Neuromodulin	67 → 238	Neuromodulin	Family

Sequence

MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQ
AAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT
EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAAT
TPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

Sequence length

238

Interactions

View interactions

	Reactome
			L1CAM interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	15059925
Hirschsprung disease	Hirschsprung Disease	rs76262710, rs75996173, rs77316810, rs75076352, rs76534745, rs76764689, rs76449634, rs377767412, rs193922699, rs75030001, rs606231342, rs1553540620, rs759944122, rs1057519322, rs1057519323 View all (4 more)	22325380
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	17012697, 22138049, 21145444, 11208668

Show/Hide Unknown Diseases (6)

Disease term	Disease name	References	Source
Unknown
Huntington disease	Huntington Disease	22325380	ClinVar
Mental depression	Mental Depression, Depressive disorder	9774774	ClinVar
Proliferative Diabetic Retinopathy	Proliferative Diabetic Retinopathy		GWAS
Metabolic Syndrome	Metabolic Syndrome		GWAS
Diabetes	Diabetes		GWAS
Borderline personality disorder	Borderline personality disorder		GWAS

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Stimulate	27604409
Alzheimer Disease	Associate	30342961, 3368468, 36611808, 36635346, 7566340, 7573369, 9011750
Alzheimer Disease	Inhibit	32776690
Anaplasia	Associate	36739296
Atrial Fibrillation	Associate	24301786
Breast Neoplasms	Associate	12495447, 35296631
CD8 Deficiency Familial	Associate	7751163
Celiac Disease	Stimulate	33686834
Cognition Disorders	Associate	32776690
Colorectal Neoplasms	Inhibit	33402155
Dementia	Inhibit	29324989
Dementia	Associate	7573369
Diabetic Neuropathies	Inhibit	23685187
Endometriosis	Associate	17412328
Glioblastoma	Associate	24601786
Glioma	Associate	34173871, 36739296
Graft vs Host Disease	Associate	6372895
Hirschsprung Disease	Associate	29654647
HIV Infections	Associate	7751163
Inflammation	Stimulate	31754174
Livedoid Vasculopathy	Associate	7573369
Lymphatic Metastasis	Stimulate	31568662
Lymphocytosis	Associate	7751163
Melanoma	Stimulate	23887302
Meningomyelocele	Associate	28735706
Microphthalmia Syndromic 10	Associate	36611808
Mouth Diseases	Associate	7573369
Multiple Sclerosis	Associate	25231264
Multiple Sclerosis	Inhibit	31754174
Multiple Sclerosis Relapsing Remitting	Stimulate	31754174
Myocardial Infarction	Associate	36759072
Neoplasms	Associate	31568662, 34173871, 36739296
Nerve Sheath Neoplasms	Associate	23887302
Neurilemmoma	Stimulate	23887302, 26121316
Neuroblastoma	Associate	17409494, 19216736, 19460840, 29507419, 33230715, 33402155, 8344386, 9006328
Neuroblastoma	Stimulate	21194500
Neurodegenerative Diseases	Associate	40229714, 7573369
Neurofibroma	Stimulate	23887302
Neurofibrosarcoma	Stimulate	23887302
Neuroma	Associate	39362479
Nevus	Associate	10433947
Pain	Associate	23685187
Parkinson Disease	Associate	26748453
Pelvic Pain	Associate	17412328
Peritoneal Diseases	Associate	17412328
Post Acute COVID 19 Syndrome	Stimulate	38231284
Retrograde Degeneration	Associate	7573369
Rupture	Associate	29385715
Schizophrenia	Associate	34667143, 8943081
Sciatic Neuropathy	Associate	34501579
Sleep Wake Disorders	Associate	40229714
Thalassemia	Associate	36066284
Thyroid Cancer Papillary	Associate	31568662
Thyroid Neoplasms	Stimulate	31568662
Urinary Bladder Neoplasms	Associate	35958598

GAP43 (growth associated protein 43)