Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25939
Gene name Gene Name - the full gene name approved by the HGNC.
SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SAMHD1
Synonyms (NCBI Gene) Gene synonyms aliases
CHBL2, DCIP, HDDC1, MOP-5, SBBI88, hSAMHD1
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene may play a role in regulation of the innate immune response. The encoded protein is upregulated in response to viral infection and may be involved in mediation of tumor necrosis factor-alpha proinflammatory responses. Mutations in this gene have
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121434517 G>A Pathogenic Stop gained, coding sequence variant
rs121434518 G>A Pathogenic Stop gained, coding sequence variant
rs121434519 G>A Pathogenic Stop gained, coding sequence variant
rs121434520 T>G Pathogenic Coding sequence variant, missense variant
rs121434521 T>C Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024909 hsa-miR-215-5p Microarray 19074876
MIRT026868 hsa-miR-192-5p Microarray 19074876
MIRT028643 hsa-miR-30a-5p Proteomics 18668040
MIRT649643 hsa-miR-6734-3p HITS-CLIP 23824327
MIRT649642 hsa-miR-3667-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000724 Process Double-strand break repair via homologous recombination IDA 28834754, 29670289
GO:0002376 Process Immune system process IEA
GO:0003676 Function Nucleic acid binding IDA 22461318
GO:0003697 Function Single-stranded DNA binding IDA 29670289
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606754 15925 ENSG00000101347
Protein
UniProt ID Q9Y3Z3
Protein name Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (dNTPase) (EC 3.1.5.-) (Dendritic cell-derived IFNG-induced protein) (DCIP) (Monocyte protein 5) (MOP-5) (SAM domain and HD domain-containing protein 1) (hSAMHD1)
Protein function Protein that acts both as a host restriction factor involved in defense response to virus and as a regulator of DNA end resection at stalled replication forks (PubMed:19525956, PubMed:21613998, PubMed:21720370, PubMed:22056990, PubMed:23601106,
PDB 2E8O , 3U1N , 4BZB , 4BZC , 4CC9 , 4MZ7 , 4Q7H , 4QFX , 4QFY , 4QFZ , 4QG0 , 4QG1 , 4QG2 , 4QG4 , 4RXO , 4RXP , 4RXQ , 4RXR , 4RXS , 4TNP , 4TNQ , 4TNR , 4TNX , 4TNY , 4TNZ , 4TO0 , 4TO1 , 4TO2 , 4TO3 , 4TO4 , 4TO5 , 4TO6 , 4ZWE , 4ZWG , 5AO0 , 5AO1 , 5AO2 , 5AO3 , 5AO4 , 6CM2 , 6DW3 , 6DW4 , 6DW5 , 6DW7 , 6DWD , 6DWJ , 6DWK , 6TX0 , 6TXA , 6TXC , 6TXE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07647 SAM_2 42 108 SAM domain (Sterile alpha motif) Domain
PF01966 HD 164 319 HD domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, skeletal muscle, spleen, liver, small intestine, placenta, lung and peripheral blood leukocytes (PubMed:11064105). No expression is seen in brain and thymus (PubMed:11064105). {ECO:0000269|PubMed:11064105}.
Sequence
MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFE
EPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLV
QIHVDTMKVIND
PIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVH
ALGEKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMM
FEHLINSNGIKPVMEQYGLIPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEI
VSNKRNGIDVDKWDYFARD
CHHLGIQNNFDYKRFIKFARVCEVDNELRICARDKEVGNLY
DMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYT
KLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEV
ASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQL
LPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWND
STSVQNPTRLREASKSRVQLFKDDPM
Sequence length 626
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Viral life cycle - HIV-1
Cytosolic DNA-sensing pathway
Human immunodeficiency virus 1 infection
  Nucleobase catabolism
Interferon alpha/beta signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Aicardi Goutieres Syndrome Aicardi-Goutieres syndrome 5 rs1601141002, rs387906948, rs1568762986, rs769561543, rs138603088, rs1303667371, rs2063480012, rs768409471, rs121434516, rs1300333132, rs121434517, rs1442728513, rs149846637, rs1219206348, rs369587937
View all (12 more)
N/A
aicardi goutieres syndrome Aicardi Goutieres syndrome rs774964432, rs138603088, rs149846637, rs768409471, rs121434517, rs267607027 N/A
Multiple myeloma multiple myeloma rs1600394490 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Chilblain Lupus Erythematosus familial chilblain lupus, chilblain lupus 2 N/A N/A GenCC
Diabetes Diabetic kidney disease in type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 35610016
Acute Retroviral Syndrome Associate 23880768, 27566548, 29321329
Acute Retroviral Syndrome Inhibit 30305425
Aicardi Goutieres syndrome Associate 19525956, 20131292, 20653736, 20842748, 21102625, 21613998, 22174685, 22530776, 22972397, 23092122, 23364794, 23592335, 24035396, 24183309, 24335234
View all (25 more)
Aicardi Goutieres syndrome 5 Associate 30275001, 36115319, 36311265
Aicardi Syndrome Associate 40442339
AIDS Arteritis Central Nervous System Associate 20653736
Aneurysm Associate 20653736
Arthritis Associate 21402907
Atherosclerosis Associate 26504826