Gene Gene information from NCBI Gene database.
Entrez ID 25937
Gene name WW domain containing transcription regulator 1
Gene symbol WWTR1
Synonyms (NCBI Gene)
TAZ
Chromosome 3
Chromosome location 3q25.1
miRNA miRNA information provided by mirtarbase database.
538
miRTarBase ID miRNA Experiments Reference
MIRT016501 hsa-miR-193b-3p Microarray 20304954
MIRT018450 hsa-miR-335-5p Microarray 18185580
MIRT050729 hsa-miR-18a-5p CLASH 23622248
MIRT635038 hsa-miR-383-3p HITS-CLIP 23824327
MIRT635036 hsa-miR-4746-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
60
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0001649 Process Osteoblast differentiation IEA
GO:0001894 Process Tissue homeostasis IEA
GO:0003015 Process Heart process IEA
GO:0003712 Function Transcription coregulator activity IDA 19010321
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607392 24042 ENSG00000018408
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9GZV5
Protein name WW domain-containing transcription regulator protein 1 (Transcriptional coactivator with PDZ-binding motif)
Protein function Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (PubMed:11118213,
PDB 5N5R , 5N5T , 5N5W , 5N75 , 6RHC , 6RJL , 6RJQ , 6RP6 , 6SLW , 6SLX , 8R0Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00397 WW 126 155 WW domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in kidney, heart, placenta and lung. Expressed in the thyroid tissue. {ECO:0000269|PubMed:11118213, ECO:0000269|PubMed:19010321}.
Sequence
MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQR
SMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL
NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Sequence length 400
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Hippo signaling pathway
Hippo signaling pathway - multiple species
  Signaling by Hippo
YAP1- and WWTR1 (TAZ)-stimulated gene expression
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Physiological factors
RUNX3 regulates YAP1-mediated transcription
EGR2 and SOX10-mediated initiation of Schwann cell myelination
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Nonpapillary renal cell carcinoma Uncertain significance rs775570561 RCV005939321
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 35941675
Breast Neoplasms Associate 25417742, 31081045, 33167967, 36308078
Carcinogenesis Associate 21584898, 28055015, 35411948
Carcinoma Associate 27129148
Carcinoma Hepatocellular Associate 34565286
Carcinoma Merkel Cell Associate 36719743
Carcinoma Renal Cell Associate 35411948, 35942760
Colorectal Neoplasms Associate 26370619
Congenital contractural arachnodactyly Associate 34615513
Endometriosis Associate 35429182