Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25932
Gene name Gene Name - the full gene name approved by the HGNC.
Chloride intracellular channel 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLIC4
Synonyms (NCBI Gene) Gene synonyms aliases
CLIC4L, H1, MTCLIC, huH1, p64H1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracel
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1557810606 C>T Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016555 hsa-miR-193b-3p Proteomics 21512034
MIRT018964 hsa-miR-335-5p Microarray 18185580
MIRT020967 hsa-miR-155-5p Proteomics 20584899
MIRT021633 hsa-miR-142-3p Microarray 17612493
MIRT023398 hsa-miR-122-5p Microarray 17612493
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IBA 21873635
GO:0001886 Process Endothelial cell morphogenesis IEA
GO:0005244 Function Voltage-gated ion channel activity IEA
GO:0005254 Function Chloride channel activity IBA 21873635
GO:0005515 Function Protein binding IPI 10793131, 12163479, 28514442, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606536 13518 ENSG00000169504
Protein
UniProt ID Q9Y696
Protein name Chloride intracellular channel protein 4 (Glutaredoxin-like oxidoreductase CLIC4) (EC 1.8.-.-) (Intracellular chloride ion channel protein p64H1)
Protein function In the soluble state, catalyzes glutaredoxin-like thiol disulfide exchange reactions with reduced glutathione as electron donor (PubMed:25581026, PubMed:37759794). Can insert into membranes and form voltage-dependent multi-ion conductive channel
PDB 2AHE , 2D2Z , 3OQS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13410 GST_C_2 134 223 Domain
Tissue specificity TISSUE SPECIFICITY: Detected in epithelial cells from colon, esophagus and kidney (at protein level). Expression is prominent in heart, kidney, placenta and skeletal muscle. {ECO:0000269|PubMed:10793131, ECO:0000269|PubMed:17200346, ECO:0000269|PubMed:176
Sequence
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLK
RKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMD
IFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLD
GNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTN
AYSRDEFTNTCPSDKEV
EIAYSDVAKRLTK
Sequence length 253
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Degenerative polyarthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 18784066
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17199135
Unknown
Disease term Disease name Evidence References Source
Hypertension Hypertension GWAS
Alzheimer disease Alzheimer disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Mucinous Inhibit 24503901
Adenocarcinoma of Lung Associate 24503901
Breast Neoplasms Associate 12163372
Carcinogenesis Associate 24503901, 32667519
Carcinoma Hepatocellular Associate 34766585
Carcinoma Merkel Cell Associate 29462791
Carcinoma Ovarian Epithelial Stimulate 30282979
Carcinoma Pancreatic Ductal Associate 28205343
Carcinoma Renal Cell Associate 37689589
Carcinoma Verrucous Associate 37026609