Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2593
Gene name Gene Name - the full gene name approved by the HGNC.
Guanidinoacetate N-methyltransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GAMT
Synonyms (NCBI Gene) Gene synonyms aliases
CCDS2, HEL-S-20, PIG2, TP53I2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CCDS2
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to cre
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs80338734 C>A,G Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs80338735 C>T Pathogenic Coding sequence variant, synonymous variant
rs80338736 ->GGCCCAGTCCCGG Pathogenic Coding sequence variant, frameshift variant
rs104894694 T>G Pathogenic Coding sequence variant, missense variant
rs121909272 C>T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1011709 hsa-miR-3545-3p CLIP-seq
MIRT1011710 hsa-miR-3663-5p CLIP-seq
MIRT1011711 hsa-miR-4496 CLIP-seq
MIRT1011712 hsa-miR-4635 CLIP-seq
MIRT1011713 hsa-miR-4680-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA 21873635
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005829 Component Cytosol TAS
GO:0006600 Process Creatine metabolic process TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601240 4136 ENSG00000130005
Protein
UniProt ID Q14353
Protein name Guanidinoacetate N-methyltransferase (EC 2.1.1.2)
Protein function Converts guanidinoacetate to creatine, using S-adenosylmethionine as the methyl donor (PubMed:24415674, PubMed:26003046, PubMed:26319512). Important in nervous system development (PubMed:24415674). {ECO:0000269|PubMed:24415674, ECO:0000269|PubMe
PDB 3ORH
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in liver. {ECO:0000269|PubMed:8651275}.
Sequence
MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSK
GGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDV
APTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKS
KYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG
Sequence length 236
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
  Creatine metabolism
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Mental retardation Profound Mental Retardation, Severe intellectual disability, Mental deficiency, Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
15651030, 8651275
Seizure Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061
View all (179 more)
15651030
Unknown
Disease term Disease name Evidence References Source
Creatine deficiency Creatine deficiency, X-linked ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Colonic Neoplasms Associate 35712285
Congenital Hereditary and Neonatal Diseases and Abnormalities Associate 35588794
Creatine deficiency X linked Associate 23234264, 28758966, 35588794, 38452609
Creatine deficiency X linked Inhibit 40338959
Immunologic Deficiency Syndromes Associate 36671459
Pancreatic Neoplasms Associate 38297362
Placenta Diseases Associate 31991880
Pre Eclampsia Stimulate 31991880
Stomach Neoplasms Associate 36790659