MDS2 (myelodysplastic syndrome 2 translocation associated)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
259283
Gene name Gene Name - the full gene name approved by the HGNC.
Myelodysplastic syndrome 2 translocation associated
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MDS2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0005615 Component Extracellular space HDA 23580065
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
607305 29633 ENSG00000197880
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8NDY4
Protein name Myelodysplastic syndrome 2 translocation-associated protein
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in peripheral blood leukocytes, spleen, thymus, kidney, pancreas and lung. {ECO:0000269|PubMed:12203785}.
Sequence 
MLQAADFIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMR
GGARGRPQLTLERPLRPGCRLHSCSEAEKGGFVRRKEIILFPPCEDPARGWLSANPGREP
SPGICWHLNLGLPSLHNCEE
Sequence length 140
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Lymphocytic Leukemia Lymphocytic Leukemia GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Myelodysplastic Syndromes Associate 12203785