Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
259283
Gene name Gene Name - the full gene name approved by the HGNC.
Myelodysplastic syndrome 2 translocation associated
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MDS2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005615 Component Extracellular space HDA 23580065
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607305 29633 ENSG00000197880
Protein
UniProt ID Q8NDY4
Protein name Myelodysplastic syndrome 2 translocation-associated protein
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in peripheral blood leukocytes, spleen, thymus, kidney, pancreas and lung. {ECO:0000269|PubMed:12203785}.
Sequence
MLQAADFIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMR
GGARGRPQLTLERPLRPGCRLHSCSEAEKGGFVRRKEIILFPPCEDPARGWLSANPGREP
SPGICWHLNLGLPSLHNCEE
Sequence length 140
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lymphocytic Leukemia Chronic lymphocytic leukemia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Myelodysplastic Syndromes Associate 12203785