MDS2 (myelodysplastic syndrome 2 translocation associated)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 259283
Gene name Myelodysplastic syndrome 2 translocation associated
Gene symbol MDS2
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1p36.11
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Gene Gene ontology Other IDs Protein
Show/Hide all (1)
GO ID Ontology Definition Evidence Reference
GO:0005615 Component Extracellular space HDA 23580065
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
607305 29633 ENSG00000197880
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NDY4
Protein name Myelodysplastic syndrome 2 translocation-associated protein
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in peripheral blood leukocytes, spleen, thymus, kidney, pancreas and lung. {ECO:0000269|PubMed:12203785}.
Sequence 
MLQAADFIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMR
GGARGRPQLTLERPLRPGCRLHSCSEAEKGGFVRRKEIILFPPCEDPARGWLSANPGREP
SPGICWHLNLGLPSLHNCEE
Sequence length 140
Interactions View interactions