LY6G6F (lymphocyte antigen 6 family member G6F)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 259215
Gene name Lymphocyte antigen 6 family member G6F
Gene symbol LY6G6F
Synonyms (NCBI Gene)
C6orf21G6fLY6G6LY6G6DNG32
Chromosome 6
Chromosome location 6p21.33
Summary The human G6f protein is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition (de Vet et al., 2003 [PubMed 12852788]).[supplied by
miRNA miRNA information provided by mirtarbase database.
14
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (14)
miRTarBase ID miRNA Experiments Reference
MIRT709774 hsa-miR-5088-3p HITS-CLIP 19536157
MIRT709773 hsa-miR-642b-5p HITS-CLIP 19536157
MIRT709772 hsa-miR-623 HITS-CLIP 19536157
MIRT709771 hsa-miR-204-5p HITS-CLIP 19536157
MIRT709770 hsa-miR-211-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (5)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 12852788
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0016020 Component Membrane IEA
GO:0031092 Component Platelet alpha granule membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
611404 13933 ENSG00000204424
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SQ64
Protein name Lymphocyte antigen 6 complex locus protein G6f
Protein function May play a role in the downstream signal transduction pathways involving GRB2 and GRB7.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 19 → 126 Immunoglobulin V-set domain Domain
Sequence 
MAVLFLLLFLCGTPQAADNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTT
LVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRV
YDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAAL
LLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPALCAPSTGWDMPWILMLL
LTMGQGVVILALSIVLWRQRVRGAPGRDASIPQFKPEIQVYENIHLARLGPPAHKPR
Sequence length 297
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Platelet degranulation