Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25915
Gene name Gene Name - the full gene name approved by the HGNC.
NADH:ubiquinone oxidoreductase complex assembly factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NDUFAF3
Synonyms (NCBI Gene) Gene synonyms aliases
2P1, C3orf60, E3-3, MC1DN18
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MC1DN18
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052369 hsa-let-7a-5p CLASH 23622248
MIRT050200 hsa-miR-25-3p CLASH 23622248
MIRT048713 hsa-miR-98-5p CLASH 23622248
MIRT723446 hsa-miR-4793-5p HITS-CLIP 19536157
MIRT723445 hsa-miR-221-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19463981, 19688755, 24344204, 25416956, 27499296, 32296183
GO:0005634 Component Nucleus IDA
GO:0005743 Component Mitochondrial inner membrane IBA 21873635
GO:0005743 Component Mitochondrial inner membrane IDA 19463981
GO:0005743 Component Mitochondrial inner membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612911 29918 ENSG00000178057
Protein
UniProt ID Q9BU61
Protein name NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
Protein function Essential factor for the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04430 DUF498 60 168 Protein of unknown function (DUF498/DUF598) Domain
Sequence
MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYI
DSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTG
DRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALI
PPPGGTSLTSLG
QAAQ
Sequence length 184
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Thermogenesis   Complex I biogenesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Cardiomyopathy Cardiomyopathy, Dilated rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Developmental regression Developmental regression rs1224421127
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure ClinVar
Ptosis Blepharoptosis, Ptosis ClinVar
Renal dysplasia Renal Cell Dysplasia, Renal dysplasia ClinVar
Mitochondrial Complex Deficiency mitochondrial complex 1 deficiency, nuclear type 18, mitochondrial complex I deficiency GenCC
Associations from Text Mining
Disease Name Relationship Type References
Mitochondrial complex I deficiency Associate 19463981
Mitochondrial Diseases Associate 19463981
Neoplasms Associate 31907990