Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25913
Gene name Gene Name - the full gene name approved by the HGNC.
Protection of telomeres 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POT1
Synonyms (NCBI Gene) Gene synonyms aliases
CMM10, CRMCC3, GLM9, HPOT1, PFBMFT8, TPDS3
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q31.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintenance. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere len
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777473 C>T Risk-factor Splice acceptor variant
rs587777474 G>C Risk-factor 5 prime UTR variant, coding sequence variant, non coding transcript variant, missense variant
rs587777476 C>A,T Risk-factor, uncertain-significance Coding sequence variant, non coding transcript variant, missense variant
rs587777477 C>T Risk-factor Coding sequence variant, non coding transcript variant, missense variant
rs587777478 C>G Risk-factor Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT516763 hsa-miR-1277-5p HITS-CLIP 21572407
MIRT550962 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT550961 hsa-miR-511-3p HITS-CLIP 21572407
MIRT550960 hsa-miR-223-5p HITS-CLIP 21572407
MIRT550959 hsa-miR-6867-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000723 Process Telomere maintenance IEA
GO:0000781 Component Chromosome, telomeric region HDA 19135898
GO:0000781 Component Chromosome, telomeric region IDA 12768206, 23685356, 24270157
GO:0000781 Component Chromosome, telomeric region IEA
GO:0000783 Component Nuclear telomere cap complex IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606478 17284 ENSG00000128513
Protein
UniProt ID Q9NUX5
Protein name Protection of telomeres protein 1 (hPot1) (POT1-like telomere end-binding protein)
Protein function Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. Is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere len
PDB 1XJV , 3KJO , 3KJP , 5H65 , 5UN7 , 7QXB , 7QXS , 7S1O , 7S1T , 7S1U , 8SH0 , 8SH1 , 8SOJ , 8SOK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02765 POT1 11 141 Telomeric single stranded DNA binding POT1/CDC13 Domain
PF16686 POT1PC 152 298 ssDNA-binding domain of telomere protection protein Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11349150, ECO:0000269|PubMed:12391173}.
Sequence
MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCL
LFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSS
KYFNFTTEDHKMVEALRVWAS
THMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFL
LKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLR
IYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLT
AN
QHSDVICQSEPDDSFPSSGSVSLYEVERCQQLSATILTDHQYLERTPLCAILKQKAPQQY
RIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYD
SKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGH
EDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQY
VFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAY
PWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI
Sequence length 634
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Recognition and association of DNA glycosylase with site containing an affected purine
Cleavage of the damaged purine
Packaging Of Telomere Ends
Telomere Extension By Telomerase
DNA Damage/Telomere Stress Induced Senescence
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
TUMOR PREDISPOSITION SYNDROME Tumor predisposition syndrome 3 rs1562981913, rs746091720, rs1554420583, rs976603098, rs918544320, rs1554434788, rs1562997292, rs1795853533, rs756198077, rs1584749232, rs1796391959, rs1554429221, rs531061783, rs1794702760, rs1554429205
View all (17 more)
N/A
neoplasm Neoplasm rs587777476 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Ankylosing Spondylitis Ankylosing spondylitis N/A N/A GWAS
Breast Carcinoma breast carcinoma N/A N/A ClinVar
Carcinoma thyroid gland carcinoma N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 33941849
Alternating hemiplegia of childhood Associate 23708666
Anemia Aplastic Associate 24892036
Ataxia Telangiectasia Associate 21399625
Ataxia Telangiectasia Inhibit 22373525
Breast Neoplasms Associate 20056641, 22527105, 22970196, 23342266, 24807106
Carcinogenesis Associate 23619786, 26365187, 28425274, 28643740, 28853721, 29546066, 31510873
Carcinoma Hepatocellular Associate 24020493
Carcinoma Non Small Cell Lung Associate 37718447
Carcinoma Squamous Cell Associate 39694330