Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2591
Gene name Gene Name - the full gene name approved by the HGNC.
Polypeptide N-acetylgalactosaminyltransferase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GALNT3
Synonyms (NCBI Gene) Gene synonyms aliases
GalNAc-T3, HFTC, HFTC1, HHS
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Indi
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137853086 G>A Pathogenic Non coding transcript variant, stop gained, coding sequence variant
rs137853087 G>A Pathogenic Stop gained, downstream transcript variant, coding sequence variant, genic downstream transcript variant
rs137853088 A>C Pathogenic Non coding transcript variant, stop gained, coding sequence variant
rs137853089 G>A Pathogenic Non coding transcript variant, stop gained, coding sequence variant
rs137853090 G>A,T Pathogenic Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019609 hsa-miR-340-5p Sequencing 20371350
MIRT022631 hsa-miR-124-3p Microarray 18668037
MIRT031681 hsa-miR-16-5p Proteomics 18668040
MIRT537258 hsa-miR-520f-3p PAR-CLIP 22012620
MIRT537246 hsa-miR-302c-3p PAR-CLIP 22012620
Transcription factors
Transcription factor Regulation Reference
NRF1 Unknown 10626815
TFAP2A Unknown 10626815
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0001958 Process Endochondral ossification IEA
GO:0002063 Process Chondrocyte development IEA
GO:0004653 Function Polypeptide N-acetylgalactosaminyltransferase activity IBA
GO:0004653 Function Polypeptide N-acetylgalactosaminyltransferase activity IDA 8663203, 9295285, 31932717
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601756 4125 ENSG00000115339
Protein
UniProt ID Q14435
Protein name Polypeptide N-acetylgalactosaminyltransferase 3 (EC 2.4.1.41) (Polypeptide GalNAc transferase 3) (GalNAc-T3) (pp-GaNTase 3) (Protein-UDP acetylgalactosaminyltransferase 3) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3)
Protein function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor (PubMed:16638743, PubMed:31932717, PubMed:8663203, PubMed:92952
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00535 Glycos_transf_2 188 374 Glycosyl transferase family 2 Family
PF00652 Ricin_B_lectin 505 627 Ricin-type beta-trefoil lectin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in organs that contain secretory epithelial glands. Highly expressed in pancreas, skin, kidney and testis. Weakly expressed in prostate, ovary, intestine and colon. Also expressed in placenta and lung and fetal lung and fetal
Sequence
MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKN
KMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNA
PGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKR
CPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYV
KQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTA
VVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTP
TFAGGLFSISKEYF
EYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSK
SPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRL
QCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGG
NQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNP
FLKMCLSANGEHPSLVSCNPSDPLQKW
ILSQND
Sequence length 633
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Mucin type O-glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
  FGFR3c ligand binding and activation
Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
O-linked glycosylation of mucins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Tumoral calcinosis tumoral calcinosis, hyperphosphatemic, familial, 1 rs137853090, rs766750282, rs760830864, rs745655924, rs786205250, rs137853086, rs267606841, rs375879489, rs762936774, rs761396172, rs775341386, rs137853087, rs137853091, rs137853088, rs137853089 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Hyperphosphatemic Tumoral Calcinosis familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome N/A N/A ClinVar
Osteoporosis Osteoporosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 11932895, 36373308
Adenocarcinoma of Lung Associate 14735190, 37919050
Anophthalmia with pulmonary hypoplasia Associate 30466404
Breast Neoplasms Stimulate 12720548
Calcinosis Associate 16567474, 18976705, 18982401, 19865099, 20358599, 27164190, 30015621, 40091336, 40149415
Carcinoma Non Small Cell Lung Associate 12232759
Carcinoma Ovarian Epithelial Associate 24504219, 27095597
Carcinoma Pancreatic Ductal Inhibit 27187683
Carcinoma Pancreatic Ductal Associate 35017635
Carcinoma Renal Cell Associate 23799843