Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	25906
Gene name Gene Name - the full gene name approved by the HGNC.	Anaphase promoting complex subunit 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ANAPC15
Synonyms (NCBI Gene) Gene synonyms aliases	APC15, C11orf51, HSPC020
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.4

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024289	hsa-miR-215-5p	Microarray	19074876
MIRT026242	hsa-miR-192-5p	Microarray	19074876

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA
GO:0005680	Component	Anaphase-promoting complex	IDA	21926987
GO:0005680	Component	Anaphase-promoting complex	IEA
GO:0005680	Component	Anaphase-promoting complex	IPI	27120157
GO:0005680	Component	Anaphase-promoting complex	NAS	27120157
GO:0005829	Component	Cytosol	TAS
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	15678131
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	29033132
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	NAS	15678131
GO:0051301	Process	Cell division	IEA
GO:0051445	Process	Regulation of meiotic cell cycle	NAS	15678131
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29033132
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	29033132
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	IBA
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	IEA
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	IMP	21926987
GO:0141198	Process	Protein branched polyubiquitination	IDA	29033132

MIM	HGNC	e!Ensembl
614717	24531	ENSG00000110200

Protein

UniProt ID

P60006

Protein name

Anaphase-promoting complex subunit 15 (APC15)

Protein function

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:21926987). The APC/C complex catalyzes assembly of bra

PDB

4UI9 , 5A31 , 5G04 , 5G05 , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15243	ANAPC15	2 → 93	Anaphase-promoting complex subunit 15	Family

Sequence

MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASE
HYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWM
I

Sequence length

121

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Ubiquitin mediated proteolysis Progesterone-mediated oocyte maturation Human T-cell leukemia virus 1 infection		Inactivation of APC/C via direct inhibition of the APC/C complex APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase Regulation of APC/C activators between G1/S and early anaphase APC/C:Cdc20 mediated degradation of mitotic proteins Phosphorylation of the APC/C APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Senescence-Associated Secretory Phenotype (SASP) CDK-mediated phosphorylation and removal of Cdc6 Transcriptional Regulation by VENTX

ANAPC15 (anaphase promoting complex subunit 15)