Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	259
Gene name Gene Name - the full gene name approved by the HGNC.	Alpha-1-microglobulin/bikunin precursor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AMBP
Synonyms (NCBI Gene) Gene synonyms aliases	A1M, EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HCP
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments
MIRT779531	hsa-miR-193a-3p	CLIP-seq
MIRT779532	hsa-miR-193b	CLIP-seq
MIRT779533	hsa-miR-3187-3p	CLIP-seq
MIRT779534	hsa-miR-345	CLIP-seq
MIRT779535	hsa-miR-4529-5p	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA	21873635
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	TAS	12817471
GO:0005515	Function	Protein binding	IPI	16364318, 25416956
GO:0005576	Component	Extracellular region	NAS	11877257, 14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	12817471
GO:0006898	Process	Receptor-mediated endocytosis	TAS
GO:0007155	Process	Cell adhesion	NAS	9570066
GO:0007565	Process	Female pregnancy	NAS	10097787
GO:0009986	Component	Cell surface	IBA	21873635
GO:0010951	Process	Negative regulation of endopeptidase activity	IEA
GO:0016032	Process	Viral process	IEA
GO:0018298	Process	Protein-chromophore linkage	IEA
GO:0019855	Function	Calcium channel inhibitor activity	NAS	12817471
GO:0019862	Function	IgA binding	IDA	11877257
GO:0020037	Function	Heme binding	IDA	11877257
GO:0030163	Process	Protein catabolic process	IEA
GO:0042167	Process	Heme catabolic process	NAS	11877257
GO:0042803	Function	Protein homodimerization activity	IPI	11883904
GO:0043231	Component	Intracellular membrane-bounded organelle	IEA
GO:0046329	Process	Negative regulation of JNK cascade	TAS	12817471
GO:0046904	Function	Calcium oxalate binding	NAS	14516400
GO:0050777	Process	Negative regulation of immune response	NAS	10097787
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	25037231, 27559042, 28675934
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072562	Component	Blood microparticle	HDA	22516433

MIM	HGNC	e!Ensembl
176870	453	ENSG00000106927

Protein

UniProt ID

P02760

Protein name

Protein AMBP (Protein HC) [Cleaved into: Alpha-1-microglobulin (EC 1.6.2.-) (Alpha-1 microglycoprotein) (Complex-forming glycoprotein heterogeneous in charge); Inter-alpha-trypsin inhibitor light chain (ITI-LC) (Bikunin) (EDC1) (HI-30) (Uronic-acid-rich p

Protein function

[Alpha-1-microglobulin]: Antioxidant and tissue repair protein with reductase, heme-binding and radical-scavenging activities. Removes and protects against harmful oxidants and repairs macromolecules in intravascular and extravascular spaces and

PDB

1BIK , 3QKG , 4ES7 , 4U30 , 6EJ7 , 6EJ8 , 6EJ9 , 6EJA , 6EJB , 6EJC , 6EJD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	41 → 186	Lipocalin / cytosolic fatty-acid binding protein family	Domain
PF00014	Kunitz_BPTI	230 → 282	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
PF00014	Kunitz_BPTI	286 → 338	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: [Alpha-1-microglobulin]: Expressed by the liver and secreted in plasma. Occurs in many physiological fluids including plasma, urine, and cerebrospinal fluid (PubMed:11877257). Expressed in epidermal keratinocytes, in dermis and epiderm

Sequence

MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIM
DRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMES
YVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIF
TMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPC
MGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFI
QLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN

Sequence length

352

Interactions

View interactions

	Reactome
			Scavenging of heme from plasma

AMBP (alpha-1-microglobulin/bikunin precursor)