Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	259
Gene name Gene Name - the full gene name approved by the HGNC.	Alpha-1-microglobulin/bikunin precursor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AMBP
Synonyms (NCBI Gene) Gene synonyms aliases	A1M, EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments
MIRT779531	hsa-miR-193a-3p	CLIP-seq
MIRT779532	hsa-miR-193b	CLIP-seq
MIRT779533	hsa-miR-3187-3p	CLIP-seq
MIRT779534	hsa-miR-345	CLIP-seq
MIRT779535	hsa-miR-4529-5p	CLIP-seq

Show/Hide all(52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	10480954, 16873769, 25301953
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	ISS
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	TAS	12817471
GO:0005515	Function	Protein binding	IPI	9183005, 16364318, 16873769, 20463016, 23157686, 25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	11877257, 14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IDA	15683711
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12817471
GO:0005886	Component	Plasma membrane	IEA
GO:0007155	Process	Cell adhesion	NAS	9570066
GO:0007565	Process	Female pregnancy	NAS	10097787
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016209	Function	Antioxidant activity	IDA	22096585, 23642167
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016653	Function	Oxidoreductase activity, acting on NAD(P)H, heme protein as acceptor	IDA	15683711
GO:0019855	Function	Calcium channel inhibitor activity	NAS	12817471
GO:0019862	Function	IgA binding	IDA	9183005, 11877257
GO:0020027	Process	Hemoglobin metabolic process	IDA	15683711
GO:0020037	Function	Heme binding	IDA	11877257
GO:0030163	Process	Protein catabolic process	IEA
GO:0030246	Function	Carbohydrate binding	EXP	7513643
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27559042, 28675934
GO:0031965	Component	Nuclear membrane	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	23157686
GO:0035374	Function	Chondroitin sulfate binding	IDA	16873769
GO:0042167	Process	Heme catabolic process	NAS	11877257
GO:0042803	Function	Protein homodimerization activity	IDA	9183005
GO:0042803	Function	Protein homodimerization activity	IPI	11883904
GO:0046329	Process	Negative regulation of JNK cascade	TAS	12817471
GO:0046904	Function	Calcium oxalate binding	NAS	14516400
GO:0050777	Process	Negative regulation of immune response	NAS	10097787
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0098633	Function	Collagen fibril binding	IDA	22096585
GO:0098869	Process	Cellular oxidant detoxification	IDA	22096585, 23642167
GO:0099617	Component	Matrix side of mitochondrial inner membrane	IDA	23157686
GO:1903606	Process	Cytochrome c metabolic process	IDA	15683711

MIM	HGNC	e!Ensembl
176870	453	ENSG00000106927

Protein

UniProt ID

P02760

Protein name

Protein AMBP (Protein HC) [Cleaved into: Alpha-1-microglobulin (EC 1.6.2.-) (Alpha-1 microglycoprotein) (Complex-forming glycoprotein heterogeneous in charge); Inter-alpha-trypsin inhibitor light chain (ITI-LC) (Bikunin) (EDC1) (HI-30) (Uronic-acid-rich p

Protein function

[Alpha-1-microglobulin]: Antioxidant and tissue repair protein with reductase, heme-binding and radical-scavenging activities. Removes and protects against harmful oxidants and repairs macromolecules in intravascular and extravascular spaces and

PDB

1BIK , 3QKG , 4ES7 , 4U30 , 6EJ7 , 6EJ8 , 6EJ9 , 6EJA , 6EJB , 6EJC , 6EJD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	41 → 186	Lipocalin / cytosolic fatty-acid binding protein family	Domain
PF00014	Kunitz_BPTI	230 → 282	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
PF00014	Kunitz_BPTI	286 → 338	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: [Alpha-1-microglobulin]: Expressed by the liver and secreted in plasma. Occurs in many physiological fluids including plasma, urine, and cerebrospinal fluid (PubMed:11877257). Expressed in epidermal keratinocytes, in dermis and epiderm

Sequence

MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIM
DRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMES
YVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIF
TMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPC
MGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFI
QLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN

Sequence length

352

Interactions

View interactions

	Reactome
			Scavenging of heme from plasma

AMBP (alpha-1-microglobulin/bikunin precursor)