ABI3BP (ABI family member 3 binding protein)

Gene

• Entrez ID: 25890
• Gene name: ABI family member 3 binding protein
• Gene symbol: ABI3BP
• Synonyms (NCBI Gene): NESHBP, TARSH
• Chromosome: 3
• Chromosome location: 3q12.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT760518	hsa-miR-2355-5p	CLIP-seq
MIRT760519	hsa-miR-3143	CLIP-seq
MIRT760520	hsa-miR-330-3p	CLIP-seq
MIRT760521	hsa-miR-3679-3p	CLIP-seq
MIRT760522	hsa-miR-3942-3p	CLIP-seq
MIRT760523	hsa-miR-4422	CLIP-seq
MIRT760524	hsa-miR-4446-5p	CLIP-seq
MIRT760525	hsa-miR-4652-3p	CLIP-seq
MIRT760526	hsa-miR-4728-3p	CLIP-seq
MIRT760527	hsa-miR-4778-5p	CLIP-seq
MIRT760528	hsa-miR-514	CLIP-seq
MIRT760529	hsa-miR-514b-3p	CLIP-seq
MIRT1545043	hsa-miR-376a	CLIP-seq
MIRT1545044	hsa-miR-376b	CLIP-seq
MIRT1545045	hsa-miR-376c	CLIP-seq
MIRT760519	hsa-miR-3143	CLIP-seq
MIRT760525	hsa-miR-4652-3p	CLIP-seq
MIRT760527	hsa-miR-4778-5p	CLIP-seq
MIRT760519	hsa-miR-3143	CLIP-seq
MIRT760525	hsa-miR-4652-3p	CLIP-seq
MIRT760527	hsa-miR-4778-5p	CLIP-seq
MIRT2467707	hsa-miR-323b-3p	CLIP-seq
MIRT2467708	hsa-miR-640	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 27559042, 28675934
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	27559042, 28675934
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	20551380

Other IDs

• MIM: 606279
• HGNC: 17265
• e!Ensembl: ENSG00000154175

Protein

• UniProt ID: Q7Z7G0
• Protein name: Target of Nesh-SH3 (Tarsh) (ABI gene family member 3-binding protein) (Nesh-binding protein) (NeshBP)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00041	fn3	839 → 923	Fibronectin type III domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, heart, lung, liver, pancreas kidney and placenta. {ECO:0000269|PubMed:11501947}.
• Sequence:

  MRGGKCNMLSSLGCLLLCGSITLALGNAQKLPKGKRPNLKVHINTTSDSILLKFLRPSPN
  VKLEGLLLGYGSNVSPNQYFPLPAEGKFTEAIVDAEPKYLIVVRPAPPPSQKKSCSGKTR
  SRKPLQLVVGTLTPSSVFLSWGFLINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQI
  CPATETIVENLKPNTVYEFGVKDNVEGGIWSKIFNHKTVVGSKKVNGKIQSTYDQDHTVP
  AYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMF
  EISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTTSSALDVSETT
  LASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIPP
  KTSRTLEQPRATLAPSETPFVPQKLEIFTSPEMQPTTPAPQQTTSIPSTPKRRPRPKPPR
  TKPERTTSAGTITPKISKSPEPTWTTPAPGKTQFISLKPKIPLSPEVTHTKPAPKQTPRA
  PPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQS
  EPAPLETRGIPFIPMISPSPSQEELQTTLEETDQSTQEPFTTKIPRTTELAKTTQAPHRF
  YTTVRPRTSDKPHIRPGVKQAPRPSGADRNVSVDSTHPTKKPGTRRPPLPPRPTHPRRKP
  LPPNNVTGKPGSAGIISSGPITTPPLRSTPRPTGTPLERIETDIKQPTVPASGEELENIT
  DFSSSPTRETDPLGKPRFKGPHVRYIQKPDNSPCSITDSVKRFPKEEATEGNATSPPQNP
  PTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNKSIQMTNQTFSTVEN
  LKPNTSYEFQVKPKNPLGEGPVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYS
  ECKGKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFL
  DGRTGQQLTSDQLPIKEGYFRAVRQEPVQFGEIGGHTQINYVQWYECGTTIPGKW

• Sequence length: 1075

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	29221444
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Unknown
Disease term	Disease name	Evidence	References	Source
Asthma	Childhood asthma, Asthma		23829686	ClinVar, GWAS
Endometriosis	Endometriosis		20864642	ClinVar
Mental depression	Unipolar Depression, Major Depressive Disorder		21041247	ClinVar
Oligodendroglioma	Oligodendroglioma			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Arthritis Rheumatoid	Associate	26359667
Asthma	Associate	27439200
Carcinoma Squamous Cell	Associate	36451444
Carcinoma Squamous Cell	Inhibit	38188687
Colorectal Neoplasms	Associate	34497681
Esophageal Neoplasms	Inhibit	32774142
Neoplasms	Associate	34946814
Osteoarthritis	Associate	35088088
Pulmonary Disease Chronic Obstructive	Associate	30111857
Thyroid Cancer Papillary	Associate	36193505