Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2589
Gene name Gene Name - the full gene name approved by the HGNC.
Polypeptide N-acetylgalactosaminyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GALNT1
Synonyms (NCBI Gene) Gene synonyms aliases
GALNAC-T1
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalN
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004049 hsa-miR-129-5p Review 20026422
MIRT005155 hsa-miR-30a-5p pSILAC 18668040
MIRT004049 hsa-miR-129-5p In situ hybridization, Microarray, qRT-PCR 19487295
MIRT004049 hsa-miR-129-5p In situ hybridization, Microarray, qRT-PCR 19487295
MIRT005155 hsa-miR-30a-5p Proteomics;Other 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0004653 Function Polypeptide N-acetylgalactosaminyltransferase activity IBA
GO:0004653 Function Polypeptide N-acetylgalactosaminyltransferase activity IDA 8690719, 9295285, 22186971
GO:0004653 Function Polypeptide N-acetylgalactosaminyltransferase activity IEA
GO:0004653 Function Polypeptide N-acetylgalactosaminyltransferase activity TAS 7592619
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602273 4123 ENSG00000141429
Protein
UniProt ID Q10472
Protein name Polypeptide N-acetylgalactosaminyltransferase 1 (EC 2.4.1.41) (Polypeptide GalNAc transferase 1) (GalNAc-T1) (pp-GaNTase 1) (Protein-UDP acetylgalactosaminyltransferase 1) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1) [Cleaved into: Polypep
Protein function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor (PubMed:8690719, PubMed:9295285). Has a broad spectrum of subst
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00535 Glycos_transf_2 119 303 Glycosyl transferase family 2 Family
PF00652 Ricin_B_lectin 430 548 Ricin-type beta-trefoil lectin domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in all tissues tested. {ECO:0000269|PubMed:7592619}.
Sequence
MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGE
MGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSV
VIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHV
IRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDV
ISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDR
DYF
QEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQ
IINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYP
DSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDD
LCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC
NGSRSQQW
LLRNVTLPEIF
Sequence length 559
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Mucin type O-glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
  COPI-independent Golgi-to-ER retrograde traffic
O-linked glycosylation of mucins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Eosinophilia Eosinophilic esophagitis N/A N/A GWAS
Hypertension Ischemic stroke in hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Ovarian Epithelial Associate 18268124, 20142253
Monoclonal Gammopathy of Undetermined Significance Associate 30134812
Neoplasm Metastasis Associate 33284788
Neoplasms Inhibit 16595896
Neoplasms Associate 36439876
Osteosarcoma Associate 33284788
Ovarian Neoplasms Associate 18268124, 20142253
Stomach Neoplasms Associate 36439876