Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25886
Gene name Gene Name - the full gene name approved by the HGNC.
POC1 centriolar protein A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POC1A
Synonyms (NCBI Gene) Gene synonyms aliases
PIX2, SOFT, WDR51A
Disease Acronyms (UniProt) Disease acronyms from UniProt database
SOFT
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
POC1 proteins contain an N-terminal WD40 domain and a C-terminal coiled coil domain and are part of centrosomes. They play an important role in basal body and cilia formation. This gene encodes one of the two POC1 proteins found in humans. Mutations in th
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs112213336 C>G Likely-pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs397514487 G>A Likely-pathogenic, pathogenic Non coding transcript variant, coding sequence variant, stop gained
rs397514488 A>G Pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs772586602 AG>- Pathogenic Non coding transcript variant, coding sequence variant, intron variant, frameshift variant
rs866964603 C>T Likely-pathogenic Missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT724035 hsa-miR-1228-3p HITS-CLIP 19536157
MIRT724034 hsa-miR-874-5p HITS-CLIP 19536157
MIRT724033 hsa-miR-663b HITS-CLIP 19536157
MIRT724032 hsa-miR-7108-5p HITS-CLIP 19536157
MIRT666923 hsa-miR-5571-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IDA 23015594
GO:0005515 Function Protein binding IPI 23015594, 25036637, 26638075, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IDA 21399614
GO:0005814 Component Centriole IDA 20008567, 23015594
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614783 24488 ENSG00000164087
Protein
UniProt ID Q8NBT0
Protein name POC1 centriolar protein homolog A (Pix2) (Proteome of centriole protein 1A) (WD repeat-containing protein 51A)
Protein function Plays an important role in centriole assembly and/or stability and ciliogenesis. Involved in early steps of centriole duplication, as well as in the later steps of centriole length control. Acts in concert with POC1B to ensure centriole integrit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 9 47 WD domain, G-beta repeat Repeat
PF00400 WD40 51 89 WD domain, G-beta repeat Repeat
PF00400 WD40 94 130 WD domain, G-beta repeat Repeat
PF00400 WD40 135 173 WD domain, G-beta repeat Repeat
PF00400 WD40 177 215 WD domain, G-beta repeat Repeat
PF00400 WD40 261 299 WD domain, G-beta repeat Repeat
Sequence
MAAPCAEDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGH
KDAVTCVNFSPSGHLLASGSRDKTVRIWV
PNVKGESTVFRAHTATVRSVHFCSDGQSFVT
ASDDKTVKVW
ATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECV
HSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWD
VRTHRLLQHYQLHSAAVNGLSFHPS
GNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS
NFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQEPVSVPQTLT
STLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQCLENQQLIMQRATP
Sequence length 407
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Fanconi anemia FANCONI ANEMIA, COMPLEMENTATION GROUP Q rs121918164, rs118203997, rs118203998, rs118203999, rs397507552, rs778507965, rs747851434, rs587776570, rs121907930, rs794726660, rs137852986, rs730880277, rs730880278, rs104894221, rs587778340
View all (653 more)
22440536
Macrocephaly Macrocephaly rs786204854, rs764333096, rs1557739557
Microcephaly Microcephaly, Primary microcephaly rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019
View all (280 more)
26791357
Unknown
Disease term Disease name Evidence References Source
Short Stature, Onychodysplasia, Facial Dysmorphism, And Hypotrichosis short stature-onychodysplasia-facial dysmorphism-hypotrichosis syndrome GenCC
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alcohol Related Disorders Associate 34419044
Alopecia Associate 28819016
Cholangiocarcinoma Associate 33725402
Ciliopathies Associate 22840364
Congenital Abnormalities Associate 22840364
Dyslipidemias Associate 28819016
Facial Dysmorphism with Multiple Malformations Associate 22840363, 26336158, 28819016
Fatty Liver Associate 26336158
Growth Disorders Associate 22840363, 26336158, 28819016, 35234134
HEM dysplasia Associate 26336158