Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2587
Gene name Gene Name - the full gene name approved by the HGNC.	Galanin receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GALR1
Synonyms (NCBI Gene) Gene synonyms aliases	GALNR, GALNR1
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q23
Summary Summary of gene provided in NCBI Entrez Gene.	The neuropeptide galanin elicits a range of biological effects by interaction with specific G-protein-coupled receptors. Galanin receptors are seven-transmembrane proteins shown to activate a variety of intracellular second-messenger pathways. GALR1 inh

Show/Hide all(35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT718909	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT718908	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT718907	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT718906	hsa-miR-411-5p	HITS-CLIP	19536157
MIRT718905	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT718904	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT718903	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT718902	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT718909	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT718908	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT718907	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT718906	hsa-miR-411-5p	HITS-CLIP	19536157
MIRT718905	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT718904	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT718903	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT718902	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT1011690	hsa-miR-1226	CLIP-seq
MIRT1011691	hsa-miR-1915	CLIP-seq
MIRT1011692	hsa-miR-204	CLIP-seq
MIRT1011693	hsa-miR-211	CLIP-seq
MIRT1011694	hsa-miR-217	CLIP-seq
MIRT1011695	hsa-miR-3125	CLIP-seq
MIRT1011696	hsa-miR-324-5p	CLIP-seq
MIRT1011697	hsa-miR-3916	CLIP-seq
MIRT1011698	hsa-miR-4418	CLIP-seq
MIRT1011699	hsa-miR-4709-3p	CLIP-seq
MIRT1011700	hsa-miR-4712-5p	CLIP-seq
MIRT1011701	hsa-miR-4726-3p	CLIP-seq
MIRT1011702	hsa-miR-4733-3p	CLIP-seq
MIRT1011703	hsa-miR-4755-5p	CLIP-seq
MIRT1011704	hsa-miR-509-3-5p	CLIP-seq
MIRT1011705	hsa-miR-509-5p	CLIP-seq
MIRT1011706	hsa-miR-623	CLIP-seq
MIRT1011707	hsa-miR-654-3p	CLIP-seq
MIRT1011708	hsa-miR-770-5p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004966	Function	Galanin receptor activity	IDA	24517231
GO:0005515	Function	Protein binding	IPI	20171159, 23597562, 25691535, 26365466, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007194	Process	Negative regulation of adenylate cyclase activity	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA	21873635
GO:0016021	Component	Integral component of membrane	TAS	7524088
GO:0017046	Function	Peptide hormone binding	IDA	24517231
GO:0042923	Function	Neuropeptide binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24517231
GO:0051464	Process	Positive regulation of cortisol secretion	IMP	17982695

MIM	HGNC	e!Ensembl
600377	4132	ENSG00000166573

Protein

UniProt ID

P47211

Protein name

Galanin receptor type 1 (GAL1-R) (GALR-1)

Protein function

Receptor for the hormone galanin. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.

PDB

7WQ3 , 7XJJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	50 → 303	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR
SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML
VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR
ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA
SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV

Sequence length

349

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Major Depressive Disorder		27940914	ClinVar

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining
Anxiety	Associate	24706871
Bile Duct Diseases	Associate	37443714
Colorectal Neoplasms	Associate	22859720, 35409094
Colorectal Neoplasms	Stimulate	36551197
Depressive Disorder	Associate	24706871
Endometrial Neoplasms	Associate	23727823
Fatigue	Associate	27720787
Ganglioneuroma	Inhibit	11857022
Glioma	Associate	31537867, 32265844
Head and Neck Neoplasms	Associate	19047085, 27685843
Hemorrhage	Associate	23727823
Mouth Neoplasms	Inhibit	29462183
Neoplasm Metastasis	Associate	36551197
Neoplasms	Associate	19047085, 27027429, 36551197
Neoplasms	Inhibit	19276245, 24168112
Neuroblastoma	Stimulate	11857022
Obesity	Associate	15930442
Parkinson Disease	Associate	34536521
Squamous Cell Carcinoma of Head and Neck	Inhibit	19047085, 29462183
Squamous Cell Carcinoma of Head and Neck	Associate	24168112, 27027429, 27685843
Stomach Neoplasms	Associate	26769141
Urinary Bladder Neoplasms	Associate	33150179
Uterine Diseases	Associate	26504828

GALR1 (galanin receptor 1)