Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25862
Gene name	Ubiquitin specific peptidase 49
Gene symbol	USP49
Synonyms (NCBI Gene)	-
Chromosome	6
Chromosome location	6p21.1

144

Show/Hide all (144)

miRTarBase ID	miRNA	Experiments	Reference
MIRT651829	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT651828	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT651827	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT651825	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT651826	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT651824	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT651823	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT651822	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT651821	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT651820	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT651819	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT651818	hsa-miR-1913	HITS-CLIP	23824327
MIRT651817	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT651816	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT651815	hsa-miR-210-5p	HITS-CLIP	23824327
MIRT651814	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT651813	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT651811	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT651812	hsa-miR-4284	HITS-CLIP	23824327
MIRT651810	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT651809	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT651808	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT651807	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT651806	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT651805	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT651804	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT651803	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT651829	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT651828	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT651827	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT651825	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT651826	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT651824	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT651823	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT651822	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT651821	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT651820	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT651819	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT651818	hsa-miR-1913	HITS-CLIP	23824327
MIRT651817	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT651816	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT651815	hsa-miR-210-5p	HITS-CLIP	23824327
MIRT651814	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT651813	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT651811	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT651812	hsa-miR-4284	HITS-CLIP	23824327
MIRT651810	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT651809	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT651808	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT651807	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT651806	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT651805	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT651804	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT651803	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT1480209	hsa-miR-150	CLIP-seq
MIRT1480210	hsa-miR-3159	CLIP-seq
MIRT1480211	hsa-miR-3174	CLIP-seq
MIRT1480212	hsa-miR-3194-3p	CLIP-seq
MIRT1480213	hsa-miR-338-5p	CLIP-seq
MIRT1480214	hsa-miR-3616-5p	CLIP-seq
MIRT1480215	hsa-miR-3647-5p	CLIP-seq
MIRT1480216	hsa-miR-371b-3p	CLIP-seq
MIRT1480217	hsa-miR-3929	CLIP-seq
MIRT1480218	hsa-miR-3934	CLIP-seq
MIRT1480219	hsa-miR-411	CLIP-seq
MIRT1480220	hsa-miR-4419b	CLIP-seq
MIRT1480221	hsa-miR-4478	CLIP-seq
MIRT1480222	hsa-miR-4666-3p	CLIP-seq
MIRT1480223	hsa-miR-4716-5p	CLIP-seq
MIRT1480224	hsa-miR-4735-5p	CLIP-seq
MIRT1480225	hsa-miR-4775	CLIP-seq
MIRT1480226	hsa-miR-4781-3p	CLIP-seq
MIRT1480227	hsa-miR-4795-5p	CLIP-seq
MIRT1480228	hsa-miR-483-5p	CLIP-seq
MIRT1480229	hsa-miR-485-3p	CLIP-seq
MIRT1480230	hsa-miR-5095	CLIP-seq
MIRT1480231	hsa-miR-518a-3p	CLIP-seq
MIRT1480232	hsa-miR-518b	CLIP-seq
MIRT1480233	hsa-miR-518c	CLIP-seq
MIRT1480234	hsa-miR-518d-3p	CLIP-seq
MIRT1480235	hsa-miR-518e	CLIP-seq
MIRT1480236	hsa-miR-518f	CLIP-seq
MIRT1480237	hsa-miR-519a	CLIP-seq
MIRT1480238	hsa-miR-519b-3p	CLIP-seq
MIRT1480239	hsa-miR-519c-3p	CLIP-seq
MIRT1480240	hsa-miR-552	CLIP-seq
MIRT1480241	hsa-miR-573	CLIP-seq
MIRT1480242	hsa-miR-590-3p	CLIP-seq
MIRT1480243	hsa-miR-629	CLIP-seq
MIRT1480244	hsa-miR-921	CLIP-seq
MIRT2144492	hsa-miR-103b	CLIP-seq
MIRT1480209	hsa-miR-150	CLIP-seq
MIRT2144493	hsa-miR-1915	CLIP-seq
MIRT2144494	hsa-miR-24	CLIP-seq
MIRT2144495	hsa-miR-3673	CLIP-seq
MIRT2144496	hsa-miR-4258	CLIP-seq
MIRT2144497	hsa-miR-4317	CLIP-seq
MIRT2144498	hsa-miR-4726-3p	CLIP-seq
MIRT2144499	hsa-miR-4772-3p	CLIP-seq
MIRT2144500	hsa-miR-520g	CLIP-seq
MIRT2144501	hsa-miR-520h	CLIP-seq
MIRT2144502	hsa-miR-891b	CLIP-seq
MIRT1480209	hsa-miR-150	CLIP-seq
MIRT2144493	hsa-miR-1915	CLIP-seq
MIRT2144494	hsa-miR-24	CLIP-seq
MIRT1480214	hsa-miR-3616-5p	CLIP-seq
MIRT1480215	hsa-miR-3647-5p	CLIP-seq
MIRT1480217	hsa-miR-3929	CLIP-seq
MIRT1480220	hsa-miR-4419b	CLIP-seq
MIRT1480221	hsa-miR-4478	CLIP-seq
MIRT2144498	hsa-miR-4726-3p	CLIP-seq
MIRT2144499	hsa-miR-4772-3p	CLIP-seq
MIRT1480227	hsa-miR-4795-5p	CLIP-seq
MIRT2364788	hsa-miR-498	CLIP-seq
MIRT1480237	hsa-miR-519a	CLIP-seq
MIRT1480238	hsa-miR-519b-3p	CLIP-seq
MIRT1480239	hsa-miR-519c-3p	CLIP-seq
MIRT1480241	hsa-miR-573	CLIP-seq
MIRT2364789	hsa-miR-764	CLIP-seq
MIRT2396764	hsa-miR-4263	CLIP-seq
MIRT2396765	hsa-miR-4666-5p	CLIP-seq
MIRT2463112	hsa-miR-1267	CLIP-seq
MIRT2463113	hsa-miR-3664-5p	CLIP-seq
MIRT2463114	hsa-miR-4423-5p	CLIP-seq
MIRT2463115	hsa-miR-4639-3p	CLIP-seq
MIRT2463116	hsa-miR-4695-3p	CLIP-seq
MIRT2463112	hsa-miR-1267	CLIP-seq
MIRT2463113	hsa-miR-3664-5p	CLIP-seq
MIRT2463114	hsa-miR-4423-5p	CLIP-seq
MIRT2463115	hsa-miR-4639-3p	CLIP-seq
MIRT2463116	hsa-miR-4695-3p	CLIP-seq
MIRT2463112	hsa-miR-1267	CLIP-seq
MIRT2463113	hsa-miR-3664-5p	CLIP-seq
MIRT1480216	hsa-miR-371b-3p	CLIP-seq
MIRT2463114	hsa-miR-4423-5p	CLIP-seq
MIRT2463115	hsa-miR-4639-3p	CLIP-seq
MIRT2463116	hsa-miR-4695-3p	CLIP-seq
MIRT1480224	hsa-miR-4735-5p	CLIP-seq
MIRT1480225	hsa-miR-4775	CLIP-seq
MIRT1480242	hsa-miR-590-3p	CLIP-seq
MIRT2144493	hsa-miR-1915	CLIP-seq
MIRT2144494	hsa-miR-24	CLIP-seq
MIRT2144498	hsa-miR-4726-3p	CLIP-seq
MIRT2144499	hsa-miR-4772-3p	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	IMP	23824326
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	23824326
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	14715245, 23824326, 28363942
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS
GO:0005515	Function	Protein binding	IPI	19615732, 23824326, 25036637, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	28363942
GO:0005737	Component	Cytoplasm	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0016579	Process	Protein deubiquitination	IDA	28363942
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0042393	Function	Histone binding	IDA	23824326
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0046872	Function	Metal ion binding	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28363942
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	17386267
GO:0140936	Function	Histone H2B deubiquitinase activity	IDA	23824326

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q70CQ1

Protein name

Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.4.19.12) (Deubiquitinating enzyme 49) (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49)

Protein function

Deubiquitinase that plays a role in several cellular processes including transcriptional regulation, cell cycle progression or innate immunity. Specifically deubiquitinates histone H2B at 'Lys-120' (H2BK120Ub), a specific tag for epigenetic tran

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02148	zf-UBP	25 → 88	Zn-finger in ubiquitin-hydrolases and other protein	Domain
PF00443	UCH	253 → 654	Ubiquitin carboxyl-terminal hydrolase	Family

Sequence

MDRCKHVGRLRLAQDHSILNPQKWCCLECATTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDTPVRRGRTLRSM
ASGEDVVLPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRQEEALER
KKEEARRRRREVKRRLLEELASTPPRKSARLLLHTPRDAGPAASRPAALPTSRRVPAATL
KLRRQPAMAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSKTEHLFPKATNGK
TQLSGKPTNSSATELSLRNDRAEACEREGFCWNGRASISRSLELIQNKEPSSKHISLCRE
LHTLFRVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGT
TRRILIPFSQRKLTKQVLKVVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH
CIEKGFVPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQL
MIYRLPQVLRLHLKRFRWSGRNHREKIGVHVVFDQVLTMEPYCCRDMLSSLDKETFAYDL
SAVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQ
GNARISETHLQAQVQSSNNDEGRPQTFS

Sequence length

688

Interactions

View interactions

	Reactome
			Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	18507837	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	28363942	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	31001918	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	31001918	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	27421018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Inhibit	28363942	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ovarian Insufficiency	Associate	32143396	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	33116468	★★★★★ ★☆☆☆☆ Found in Text Mining only

USP49 (ubiquitin specific peptidase 49)