Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	25850
Gene name	Zinc finger protein 345
Gene symbol	ZNF345
Synonyms (NCBI Gene)	HZF10
Chromosome	19
Chromosome location	19q13.12

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT514283	hsa-miR-6771-3p	PAR-CLIP	21572407
MIRT514284	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT514279	hsa-miR-520f-5p	PAR-CLIP	21572407
MIRT514278	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT514277	hsa-miR-3926	PAR-CLIP	21572407
MIRT514276	hsa-miR-548s	PAR-CLIP	21572407
MIRT514283	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT514284	hsa-miR-3675-3p	PAR-CLIP	23446348
MIRT514282	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT514281	hsa-miR-221-5p	PAR-CLIP	23446348
MIRT514280	hsa-miR-8073	PAR-CLIP	23446348
MIRT514279	hsa-miR-520f-5p	PAR-CLIP	23446348
MIRT514278	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514277	hsa-miR-3926	PAR-CLIP	23446348
MIRT514276	hsa-miR-548s	PAR-CLIP	23446348
MIRT514283	hsa-miR-6771-3p	PAR-CLIP	21572407
MIRT514284	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT514279	hsa-miR-520f-5p	PAR-CLIP	21572407
MIRT514278	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT514277	hsa-miR-3926	PAR-CLIP	21572407
MIRT514276	hsa-miR-548s	PAR-CLIP	21572407
MIRT514283	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT514284	hsa-miR-3675-3p	PAR-CLIP	23446348
MIRT514282	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT514281	hsa-miR-221-5p	PAR-CLIP	23446348
MIRT514280	hsa-miR-8073	PAR-CLIP	23446348
MIRT514279	hsa-miR-520f-5p	PAR-CLIP	23446348
MIRT514278	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514277	hsa-miR-3926	PAR-CLIP	23446348
MIRT514276	hsa-miR-548s	PAR-CLIP	23446348
MIRT1522901	hsa-miR-3170	CLIP-seq
MIRT1522902	hsa-miR-342-5p	CLIP-seq
MIRT1522903	hsa-miR-3671	CLIP-seq
MIRT1522904	hsa-miR-4260	CLIP-seq
MIRT1522905	hsa-miR-4651	CLIP-seq
MIRT1522906	hsa-miR-4664-5p	CLIP-seq
MIRT1522907	hsa-miR-577	CLIP-seq
MIRT1522908	hsa-miR-607	CLIP-seq
MIRT1522909	hsa-miR-608	CLIP-seq
MIRT1522910	hsa-miR-4678	CLIP-seq
MIRT1522911	hsa-miR-4786-5p	CLIP-seq
MIRT1522912	hsa-miR-4799-5p	CLIP-seq
MIRT1522913	hsa-miR-548m	CLIP-seq
MIRT1522914	hsa-miR-552	CLIP-seq
MIRT1522915	hsa-miR-132	CLIP-seq
MIRT1522916	hsa-miR-1827	CLIP-seq
MIRT1522917	hsa-miR-194	CLIP-seq
MIRT1522918	hsa-miR-2114	CLIP-seq
MIRT1522919	hsa-miR-212	CLIP-seq
MIRT1522920	hsa-miR-3150a-3p	CLIP-seq
MIRT1522921	hsa-miR-3160-3p	CLIP-seq
MIRT1522922	hsa-miR-3175	CLIP-seq
MIRT1522923	hsa-miR-3613-3p	CLIP-seq
MIRT1522924	hsa-miR-3672	CLIP-seq
MIRT1522925	hsa-miR-371-5p	CLIP-seq
MIRT1522926	hsa-miR-371b-5p	CLIP-seq
MIRT1522927	hsa-miR-4299	CLIP-seq
MIRT1522928	hsa-miR-4300	CLIP-seq
MIRT1522929	hsa-miR-4645-3p	CLIP-seq
MIRT1522930	hsa-miR-4649-3p	CLIP-seq
MIRT1522931	hsa-miR-4667-5p	CLIP-seq
MIRT1522932	hsa-miR-4700-5p	CLIP-seq
MIRT1522933	hsa-miR-542-3p	CLIP-seq
MIRT1522934	hsa-miR-548a-5p	CLIP-seq
MIRT1522935	hsa-miR-548ab	CLIP-seq
MIRT1522936	hsa-miR-548ak	CLIP-seq
MIRT1522937	hsa-miR-548b-5p	CLIP-seq
MIRT1522938	hsa-miR-548c-5p	CLIP-seq
MIRT1522939	hsa-miR-548d-5p	CLIP-seq
MIRT1522940	hsa-miR-548h	CLIP-seq
MIRT1522941	hsa-miR-548i	CLIP-seq
MIRT1522942	hsa-miR-548j	CLIP-seq
MIRT1522943	hsa-miR-548w	CLIP-seq
MIRT1522944	hsa-miR-548y	CLIP-seq
MIRT1522945	hsa-miR-559	CLIP-seq
MIRT1522946	hsa-miR-566	CLIP-seq
MIRT1522947	hsa-miR-591	CLIP-seq
MIRT1522948	hsa-miR-802	CLIP-seq
MIRT1522949	hsa-miR-920	CLIP-seq
MIRT1522950	hsa-miR-939	CLIP-seq
MIRT1522951	hsa-miR-940	CLIP-seq
MIRT1522916	hsa-miR-1827	CLIP-seq
MIRT1522930	hsa-miR-4649-3p	CLIP-seq
MIRT1522951	hsa-miR-940	CLIP-seq
MIRT2377462	hsa-miR-1268	CLIP-seq
MIRT2377463	hsa-miR-1268b	CLIP-seq
MIRT2377464	hsa-miR-1908	CLIP-seq
MIRT2377465	hsa-miR-205	CLIP-seq
MIRT1522918	hsa-miR-2114	CLIP-seq
MIRT2377466	hsa-miR-25	CLIP-seq
MIRT2377467	hsa-miR-3065-3p	CLIP-seq
MIRT2377468	hsa-miR-32	CLIP-seq
MIRT2377469	hsa-miR-363	CLIP-seq
MIRT2377470	hsa-miR-3667-3p	CLIP-seq
MIRT2377471	hsa-miR-367	CLIP-seq
MIRT2377472	hsa-miR-3689d	CLIP-seq
MIRT2377473	hsa-miR-4291	CLIP-seq
MIRT1522927	hsa-miR-4299	CLIP-seq
MIRT2377474	hsa-miR-4486	CLIP-seq
MIRT2377475	hsa-miR-4523	CLIP-seq
MIRT1522929	hsa-miR-4645-3p	CLIP-seq
MIRT2377476	hsa-miR-4767	CLIP-seq
MIRT2377477	hsa-miR-4793-3p	CLIP-seq
MIRT2377478	hsa-miR-508-5p	CLIP-seq
MIRT1522933	hsa-miR-542-3p	CLIP-seq
MIRT1522946	hsa-miR-566	CLIP-seq
MIRT2377479	hsa-miR-585	CLIP-seq
MIRT2377480	hsa-miR-663	CLIP-seq
MIRT2377481	hsa-miR-766	CLIP-seq
MIRT2377482	hsa-miR-767-5p	CLIP-seq
MIRT2377483	hsa-miR-92a	CLIP-seq
MIRT2377484	hsa-miR-92b	CLIP-seq
MIRT2377462	hsa-miR-1268	CLIP-seq
MIRT2377463	hsa-miR-1268b	CLIP-seq
MIRT2377464	hsa-miR-1908	CLIP-seq
MIRT1522923	hsa-miR-3613-3p	CLIP-seq
MIRT2669906	hsa-miR-3647-3p	CLIP-seq
MIRT1522924	hsa-miR-3672	CLIP-seq
MIRT1522925	hsa-miR-371-5p	CLIP-seq
MIRT1522926	hsa-miR-371b-5p	CLIP-seq
MIRT2377474	hsa-miR-4486	CLIP-seq
MIRT1522911	hsa-miR-4786-5p	CLIP-seq
MIRT2377479	hsa-miR-585	CLIP-seq
MIRT2377480	hsa-miR-663	CLIP-seq
MIRT2377462	hsa-miR-1268	CLIP-seq
MIRT2377463	hsa-miR-1268b	CLIP-seq
MIRT2377464	hsa-miR-1908	CLIP-seq
MIRT1522923	hsa-miR-3613-3p	CLIP-seq
MIRT2669906	hsa-miR-3647-3p	CLIP-seq
MIRT2377474	hsa-miR-4486	CLIP-seq
MIRT2377476	hsa-miR-4767	CLIP-seq
MIRT1522911	hsa-miR-4786-5p	CLIP-seq
MIRT1522946	hsa-miR-566	CLIP-seq
MIRT2377479	hsa-miR-585	CLIP-seq
MIRT2377480	hsa-miR-663	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	9278146
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006359	Process	Regulation of transcription by RNA polymerase III	TAS	9278146
GO:0006366	Process	Transcription by RNA polymerase II	TAS	9278146
GO:0006383	Process	Transcription by RNA polymerase III	TAS	9278146
GO:0008270	Function	Zinc ion binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
621272	16367	ENSG00000251247

Q14585

Protein name

Zinc finger protein 345 (Zinc finger protein HZF10)

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13465	zf-H2C2_2	76 → 101		Domain
PF00096	zf-C2H2	118 → 140	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	146 → 168	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	174 → 196	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	202 → 224	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	230 → 252	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	258 → 280	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	286 → 308	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	314 → 336	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	342 → 364	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	370 → 392	Zinc finger, C2H2 type	Domain
PF13465	zf-H2C2_2	412 → 437		Domain
PF00096	zf-C2H2	454 → 476	Zinc finger, C2H2 type	Domain

Sequence

MENLTKHSIECSSFRGDWECKNQFERKQGSQEGHFSEMIFTPEDMPTFSIQHQRIHTDEK
LLECKECGKDFSFVSVLVRHQRIHTGEKPYECKECGKAFGSGANLAYHQRIHTGEKPFEC
KECGKAFGSGSNLTHHQRIHTGEKPYECKECGKAFSFGSGLIRHQIIHSGEKPYECKECG
KSFSFESALIRHHRIHTGEKPYECIDCGKAFGSGSNLTQHRRIHTGEKPYECKACGMAFS
SGSALTRHQRIHTGEKPYICNECGKAFSFGSALTRHQRIHTGEKPYVCKECGKAFNSGSD
LTQHQRIHTGEKPYECKECEKAFRSGSKLIQHQRMHTGEKPYECKECGKTFSSGSDLTQH
HRIHTGEKPYECKECGKAFGSGSKLIQHQLIHTGERPYECKECGKSFSSGSALNRHQRIH
TGEKPYECKECGKAFYSGSSLTQHQRIHTGEKLYECKNCGKAYGRDSEFQQHKKSHNGKK
LCELETIN

Sequence length

488

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
NEPHROTIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Barrett Esophagus	Associate	29084829	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	32541446	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ZNF345 (zinc finger protein 345)