Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25844
Gene name Gene Name - the full gene name approved by the HGNC.
Yip1 domain family member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
YIPF3
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf109, FinGER3, KLIP1, YIPFbeta2, Yip5b, dJ337H4.3
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052300 hsa-let-7b-5p CLASH 23622248
MIRT041315 hsa-miR-193b-3p CLASH 23622248
MIRT039935 hsa-miR-615-3p CLASH 23622248
MIRT496788 hsa-miR-624-5p PAR-CLIP 22291592
MIRT496788 hsa-miR-624-5p PAR-CLIP 22291592
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956, 28514442, 31515488, 32296183
GO:0005794 Component Golgi apparatus IBA 21873635
GO:0005794 Component Golgi apparatus IDA
GO:0005886 Component Plasma membrane IEA
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609775 21023 ENSG00000137207
Protein
UniProt ID Q9GZM5
Protein name Protein YIPF3 (Killer lineage protein 1) (Natural killer cell-specific antigen KLIP1) (YIP1 family member 3) [Cleaved into: Protein YIPF3, 36 kDa form III]
Protein function Involved in the maintenance of the Golgi structure. May play a role in hematopoiesis.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed by nucleated hematopoietic cells (at protein level). {ECO:0000269|PubMed:12490290}.
Sequence
MATTAAPAGGARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREE
EVDADAADAAAAEEEDGEFLGMKGFKGQLSRQVADQMWQAGKRQASRAFSLYANIDILRP
YFDVEPAQVRSRLLESMIPIKMVNFPQKIAGELYGPLMLVFTLVAILLHGMKTSDTIIRE
GTLMGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQMLALLGYGLFGHCIVLFITYNIH
LHALFYLFWLLVGGLSTLRMVAVLVSRTVGPTQRLLLCGTLAALHMLFLLYLHFAYHKVV
EGILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH
Sequence length 350
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Papillary renal carcinoma Papillary Renal Cell Carcinoma rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724 23797736
Renal carcinoma Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney rs121913668, rs121913670, rs121913243, rs786202724 23797736
Unknown
Disease term Disease name Evidence References Source
Chromophobe carcinoma Chromophobe Renal Cell Carcinoma 23797736 ClinVar