Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2584
Gene name Gene Name - the full gene name approved by the HGNC.
Galactokinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GALK1
Synonyms (NCBI Gene) Gene synonyms aliases
GALK, GK1, HEL-S-19
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs80084721 G>A,T Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs104894572 G>A,T Pathogenic Missense variant, coding sequence variant
rs104894577 C>A Pathogenic Stop gained, coding sequence variant
rs113464656 C>A,G,T Likely-pathogenic Splice donor variant
rs376790302 G>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029752 hsa-miR-26b-5p Microarray 19088304
MIRT040306 hsa-miR-615-3p CLASH 23622248
MIRT036546 hsa-miR-1225-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004335 Function Galactokinase activity EXP 7542884
GO:0004335 Function Galactokinase activity IBA 21873635
GO:0004335 Function Galactokinase activity IDA 7542884, 12694189
GO:0005515 Function Protein binding IPI 32296183
GO:0005524 Function ATP binding IDA 12694189
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604313 4118 ENSG00000108479
Protein
UniProt ID P51570
Protein name Galactokinase (EC 2.7.1.6) (Galactose kinase)
Protein function Catalyzes the transfer of a phosphate from ATP to alpha-D-galactose and participates in the first committed step in the catabolism of galactose.
PDB 1WUU , 6GR2 , 6Q3W , 6Q3X , 6Q8Z , 6Q90 , 6Q91 , 6QJE , 6ZFH , 6ZGV , 6ZGW , 6ZGX , 6ZGY , 6ZGZ , 6ZH0 , 7OZX , 7RCL , 7RCM , 7S49 , 7S4C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10509 GalKase_gal_bdg 18 67 Galactokinase galactose-binding signature Domain
PF00288 GHMP_kinases_N 126 194 GHMP kinases N terminal domain Family
PF08544 GHMP_kinases_C 291 374 GHMP kinases C terminal Family
Sequence
MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELM
TVLVGSP
RKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAA
PLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGM
PCGIMDQFISLMGQ
KGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRR
RQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDY
RAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASA
APHAMRHIQEHYGG
TATFYLSQAADGAKVLCL
Sequence length 392
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of nucleotide sugars
  Defective GALK1 can cause Galactosemia II (GALCT2)
Galactose catabolism
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cataract Cataract, Pseudoaphakia rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322
View all (150 more)
7670469
Deficiency of galactokinase Deficiency of galactokinase rs104894577, rs104894572, rs111033608, rs1599335144, rs113464656, rs1026685248, rs770087254, rs1555748556, rs771067891, rs1555748940, rs1311294794, rs371517491, rs1555748534, rs767329054, rs1568395061
View all (2 more)
10521295, 12694189, 10790206, 11231902, 7670469, 11978884, 15024738, 10570908, 12647253, 27604308, 11978883, 20405025, 11139256, 21290184
Epidermolysis bullosa Epidermolysis bullosa with pyloric atresia rs137852757, rs80356682, rs80356680, rs786205094, rs121912482, rs786205095, rs587776813, rs121912487, rs587776814, rs1558092501, rs80356683, rs118203899, rs118203900, rs1558095794, rs118203901
View all (97 more)
10484780, 12485428
Galactosemia Galactosemias, Classical galactosemia rs111033695, rs111033800, rs111033715, rs111033690, rs111033773, rs111033658, rs111033661, rs111033670, rs111033667, rs111033681, rs111033689, rs111033686, rs111033694, rs367543258, rs111033718
View all (32 more)
7670469
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma GWAS
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Attention Deficit Disorder with Hyperactivity Associate 33115496
Blindness Associate 10521295
Brain Diseases Associate 32807972, 38353984
Cataract Associate 12694189, 12942049, 173185, 32807972, 8908517
Cataract Autosomal Dominant Nuclear Associate 20405025
Cognition Disorders Associate 32807972
Colorectal Neoplasms Associate 35963622
Galactosemias Associate 10521295, 12694189, 173185, 18490662, 29261178, 32807972, 34088690, 8908517
Galactosemias Inhibit 20863731
Genetic Diseases Inborn Associate 12694189, 28418495