Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2583
Gene name Gene Name - the full gene name approved by the HGNC.
Beta-1,4-N-acetyl-galactosaminyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
B4GALNT1
Synonyms (NCBI Gene) Gene synonyms aliases
GALGT, GALNACT, GalNAc-T, SPG26
Disease Acronyms (UniProt) Disease acronyms from UniProt database
SPG26
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, result
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs377445018 C>T Likely-pathogenic Splice donor variant
rs398122382 G>A Pathogenic Stop gained, non coding transcript variant, coding sequence variant, 5 prime UTR variant
rs745744124 C>-,CC Likely-pathogenic, pathogenic Coding sequence variant, 5 prime UTR variant, intron variant, frameshift variant, non coding transcript variant
rs766591558 G>- Pathogenic Coding sequence variant, frameshift variant, non coding transcript variant, 5 prime UTR variant
rs879255241 G>A Pathogenic 5 prime UTR variant, stop gained, non coding transcript variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT813458 hsa-miR-2467-3p CLIP-seq
MIRT813459 hsa-miR-3678-3p CLIP-seq
MIRT813460 hsa-miR-4310 CLIP-seq
MIRT1940489 hsa-miR-1236 CLIP-seq
MIRT1940490 hsa-miR-2113 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane ISS
GO:0000139 Component Golgi membrane TAS
GO:0001574 Process Ganglioside biosynthetic process IBA 21873635
GO:0001574 Process Ganglioside biosynthetic process IDA 7487055, 7890749
GO:0001574 Process Ganglioside biosynthetic process IMP 1601877
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601873 4117 ENSG00000135454
Protein
UniProt ID Q00973
Protein name Beta-1,4 N-acetylgalactosaminyltransferase 1 (EC 2.4.1.92) ((N-acetylneuraminyl)-galactosylglucosylceramide) (GM2/GD2 synthase) (GalNAc-T)
Protein function Involved in the biosynthesis of gangliosides GM2, GD2, GT2 and GA2 from GM3, GD3, GT3 and GA3, respectively.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00535 Glycos_transf_2 280 450 Glycosyl transferase family 2 Family
Sequence
MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRY
AHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQ
EFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNL
TASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRF
STEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIR
RFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFV
FTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFH
HELVGFPGCVVTDGVVNFFLARTDKVREVG
FDPRLSRVAHLEFFLDGLGSLRVGSCSDVV
VDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
Sequence length 533
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
  Glycosphingolipid metabolism
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cataract Cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322
View all (150 more)
Mental retardation Mild Mental Retardation, Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Scoliosis Scoliosis, unspecified rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085
Spastic paraplegia Spastic Paraplegia, Autosomal recessive spastic paraplegia type 26 rs118204049, rs121918262, rs104894490, rs119476046, rs281865117, rs281865118, rs137853017, rs72554620, rs121908610, rs121908611, rs121908613, rs116171274, rs121434442, rs121434443, rs137852520
View all (368 more)
Unknown
Disease term Disease name Evidence References Source
Distal amyotrophy Distal amyotrophy ClinVar
Spastic Paraplegia hereditary spastic paraplegia 26, complex hereditary spastic paraplegia GenCC
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 32310165
Carcinogenesis Associate 35935585
Carcinoma Renal Cell Associate 15178323
Cerebral Palsy Associate 35775650
Congenital Hereditary and Neonatal Diseases and Abnormalities Associate 22566642
Dysarthria Associate 35775650
Echinococcosis Associate 36631795
Gait Disorders Neurologic Associate 35775650
Gastrointestinal Neoplasms Associate 11856818
Hereditary Breast and Ovarian Cancer Syndrome Associate 23479608