Gene Gene information from NCBI Gene database.
Entrez ID 25827
Gene name F-box and leucine rich repeat protein 2
Gene symbol FBXL2
Synonyms (NCBI Gene)
FBL2FBL3
Chromosome 3
Chromosome location 3p22.3
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
miRNA miRNA information provided by mirtarbase database.
271
miRTarBase ID miRNA Experiments Reference
MIRT030985 hsa-miR-21-5p Microarray 18591254
MIRT042990 hsa-miR-324-3p CLASH 23622248
MIRT679732 hsa-miR-302a-3p HITS-CLIP 23824327
MIRT679731 hsa-miR-302b-3p HITS-CLIP 23824327
MIRT679730 hsa-miR-302c-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15893726, 18160438, 19159283, 22939624, 25036637, 26790640, 27705803, 32296183, 32814053, 33961781
GO:0005516 Function Calmodulin binding IEA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm TAS 10508920
GO:0006508 Process Proteolysis TAS 10531035
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605652 13598 ENSG00000153558
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKC9
Protein name F-box/LRR-repeat protein 2 (F-box and leucine-rich repeat protein 2) (F-box protein FBL2/FBL3)
Protein function Calcium-activated substrate recognition component of the SCF (SKP1-cullin-F-box protein) E3 ubiquitin-protein ligase complex, SCF(FBXL2), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:2202032
PDB 6O60
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00646 F-box 13 57 F-box domain Domain
PF13516 LRR_6 128 152 Leucine Rich repeat Repeat
PF13516 LRR_6 154 178 Leucine Rich repeat Repeat
PF13516 LRR_6 206 230 Leucine Rich repeat Repeat
PF13516 LRR_6 310 334 Leucine Rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas and placenta. {ECO:0000269|PubMed:10531037}.
Sequence
MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNF
QTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDS
TCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRG
CRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALC
LSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILIT
DSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALE
HLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC
VIL
Sequence length 423
Interactions View interactions