Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	25824
Gene name Gene Name - the full gene name approved by the HGNC.	Peroxiredoxin 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRDX5
Synonyms (NCBI Gene) Gene synonyms aliases	ACR1, AOEB166, B166, HEL-S-55, PLP, PMP20, PRDX6, PRXV, SBBI10, prx-V
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues

Show/Hide all(148)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037717	hsa-miR-744-5p	CLASH	23622248
MIRT470292	hsa-miR-302f	PAR-CLIP	23592263
MIRT470291	hsa-miR-1265	PAR-CLIP	23592263
MIRT470290	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT470289	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT470288	hsa-miR-1205	PAR-CLIP	23592263
MIRT470287	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT470286	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT470285	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT470284	hsa-miR-1286	PAR-CLIP	23592263
MIRT470282	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT470283	hsa-miR-4764-5p	PAR-CLIP	23592263
MIRT737179	hsa-miR-6855-3p	Luciferase reporter assay, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR	31987042
MIRT738987	hsa-miR-1909	HITS-CLIP	33718276
MIRT738988	hsa-miR-543	HITS-CLIP	33718276
MIRT470292	hsa-miR-302f	PAR-CLIP	23592263
MIRT470291	hsa-miR-1265	PAR-CLIP	23592263
MIRT470290	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT470289	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT470288	hsa-miR-1205	PAR-CLIP	23592263
MIRT470287	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT470286	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT470285	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT470284	hsa-miR-1286	PAR-CLIP	23592263
MIRT470282	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT470283	hsa-miR-4764-5p	PAR-CLIP	23592263
MIRT1260545	hsa-miR-125a-3p	CLIP-seq
MIRT1260546	hsa-miR-1285	CLIP-seq
MIRT1260547	hsa-miR-1321	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260549	hsa-miR-3162-5p	CLIP-seq
MIRT1260550	hsa-miR-3176	CLIP-seq
MIRT1260551	hsa-miR-3187-5p	CLIP-seq
MIRT1260552	hsa-miR-3665	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260553	hsa-miR-3922-3p	CLIP-seq
MIRT1260554	hsa-miR-3926	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260556	hsa-miR-4492	CLIP-seq
MIRT1260557	hsa-miR-4498	CLIP-seq
MIRT1260558	hsa-miR-4505	CLIP-seq
MIRT1260559	hsa-miR-4736	CLIP-seq
MIRT1260560	hsa-miR-4739	CLIP-seq
MIRT1260561	hsa-miR-4756-5p	CLIP-seq
MIRT1260562	hsa-miR-548s	CLIP-seq
MIRT1260563	hsa-miR-612	CLIP-seq
MIRT1260564	hsa-miR-762	CLIP-seq
MIRT1260565	hsa-miR-137	CLIP-seq
MIRT1260566	hsa-miR-25	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260567	hsa-miR-298	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260568	hsa-miR-32	CLIP-seq
MIRT1260569	hsa-miR-363	CLIP-seq
MIRT1260570	hsa-miR-367	CLIP-seq
MIRT1260571	hsa-miR-3678-3p	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260572	hsa-miR-92a	CLIP-seq
MIRT1260573	hsa-miR-92b	CLIP-seq
MIRT1260545	hsa-miR-125a-3p	CLIP-seq
MIRT1260546	hsa-miR-1285	CLIP-seq
MIRT1260547	hsa-miR-1321	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260549	hsa-miR-3162-5p	CLIP-seq
MIRT1260551	hsa-miR-3187-5p	CLIP-seq
MIRT1260552	hsa-miR-3665	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260556	hsa-miR-4492	CLIP-seq
MIRT1260557	hsa-miR-4498	CLIP-seq
MIRT1260558	hsa-miR-4505	CLIP-seq
MIRT1552551	hsa-miR-4651	CLIP-seq
MIRT1552552	hsa-miR-4728-5p	CLIP-seq
MIRT1260559	hsa-miR-4736	CLIP-seq
MIRT1260560	hsa-miR-4739	CLIP-seq
MIRT1260561	hsa-miR-4756-5p	CLIP-seq
MIRT1552553	hsa-miR-608	CLIP-seq
MIRT1260563	hsa-miR-612	CLIP-seq
MIRT1260564	hsa-miR-762	CLIP-seq
MIRT1552554	hsa-miR-765	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260545	hsa-miR-125a-3p	CLIP-seq
MIRT1260546	hsa-miR-1285	CLIP-seq
MIRT1260547	hsa-miR-1321	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260549	hsa-miR-3162-5p	CLIP-seq
MIRT1260551	hsa-miR-3187-5p	CLIP-seq
MIRT1260552	hsa-miR-3665	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260556	hsa-miR-4492	CLIP-seq
MIRT1260557	hsa-miR-4498	CLIP-seq
MIRT1260558	hsa-miR-4505	CLIP-seq
MIRT1552551	hsa-miR-4651	CLIP-seq
MIRT1552552	hsa-miR-4728-5p	CLIP-seq
MIRT1260559	hsa-miR-4736	CLIP-seq
MIRT1260560	hsa-miR-4739	CLIP-seq
MIRT1260561	hsa-miR-4756-5p	CLIP-seq
MIRT1552553	hsa-miR-608	CLIP-seq
MIRT1260563	hsa-miR-612	CLIP-seq
MIRT1260564	hsa-miR-762	CLIP-seq
MIRT1552554	hsa-miR-765	CLIP-seq
MIRT1260545	hsa-miR-125a-3p	CLIP-seq
MIRT1260546	hsa-miR-1285	CLIP-seq
MIRT1260547	hsa-miR-1321	CLIP-seq
MIRT1260565	hsa-miR-137	CLIP-seq
MIRT1260566	hsa-miR-25	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260567	hsa-miR-298	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260549	hsa-miR-3162-5p	CLIP-seq
MIRT1260550	hsa-miR-3176	CLIP-seq
MIRT1260551	hsa-miR-3187-5p	CLIP-seq
MIRT1260568	hsa-miR-32	CLIP-seq
MIRT1260569	hsa-miR-363	CLIP-seq
MIRT1260552	hsa-miR-3665	CLIP-seq
MIRT1260570	hsa-miR-367	CLIP-seq
MIRT1260571	hsa-miR-3678-3p	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260553	hsa-miR-3922-3p	CLIP-seq
MIRT1260554	hsa-miR-3926	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260556	hsa-miR-4492	CLIP-seq
MIRT1260557	hsa-miR-4498	CLIP-seq
MIRT1260558	hsa-miR-4505	CLIP-seq
MIRT1552551	hsa-miR-4651	CLIP-seq
MIRT1552552	hsa-miR-4728-5p	CLIP-seq
MIRT1260559	hsa-miR-4736	CLIP-seq
MIRT1260560	hsa-miR-4739	CLIP-seq
MIRT1260561	hsa-miR-4756-5p	CLIP-seq
MIRT1260562	hsa-miR-548s	CLIP-seq
MIRT1552553	hsa-miR-608	CLIP-seq
MIRT1260563	hsa-miR-612	CLIP-seq
MIRT1260564	hsa-miR-762	CLIP-seq
MIRT1552554	hsa-miR-765	CLIP-seq
MIRT1260572	hsa-miR-92a	CLIP-seq
MIRT1260573	hsa-miR-92b	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260550	hsa-miR-3176	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260553	hsa-miR-3922-3p	CLIP-seq
MIRT1260554	hsa-miR-3926	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260562	hsa-miR-548s	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
DEK	Repression	19229864
NRF1	Activation	21051700

Show/Hide all(53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001016	Function	RNA polymerase III transcription regulatory region sequence-specific DNA binding	IDA	10095767
GO:0004601	Function	Peroxidase activity	IDA	10521424
GO:0004601	Function	Peroxidase activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	10514471
GO:0005515	Function	Protein binding	IPI	10514471, 29128334, 32296183
GO:0005615	Component	Extracellular space	HDA	23580065
GO:0005634	Component	Nucleus	IDA	10095767, 15785239
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10514471, 15785239
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	10521424, 10751410, 18262354, 31740833
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IDA	10521424, 10751410
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	IDA	10514471
GO:0005782	Component	Peroxisomal matrix	IEA
GO:0005829	Component	Cytosol	IDA	18262354
GO:0005829	Component	Cytosol	TAS
GO:0006954	Process	Inflammatory response	TAS	10521424
GO:0006979	Process	Response to oxidative stress	IDA	10514471, 10521424
GO:0008379	Function	Thioredoxin peroxidase activity	EXP	15280035
GO:0008379	Function	Thioredoxin peroxidase activity	IBA
GO:0008379	Function	Thioredoxin peroxidase activity	IDA	10751410
GO:0008379	Function	Thioredoxin peroxidase activity	IEA
GO:0016209	Function	Antioxidant activity	IDA	10514471
GO:0016209	Function	Antioxidant activity	IEA
GO:0016480	Process	Negative regulation of transcription by RNA polymerase III	IDA	10095767
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	10095767
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	15276323
GO:0034599	Process	Cellular response to oxidative stress	IBA
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	TAS
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	18262354
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	10514471
GO:0042802	Function	Identical protein binding	IPI	15046979
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	18262354
GO:0043066	Process	Negative regulation of apoptotic process	IMP	18262354
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	15785239
GO:0045454	Process	Cell redox homeostasis	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10095767
GO:0051354	Process	Negative regulation of oxidoreductase activity	IDA	15280035
GO:0060785	Process	Regulation of apoptosis involved in tissue homeostasis	IDA	15276323
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0072541	Function	Peroxynitrite reductase activity	IDA	15280035
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0140824	Function	Thioredoxin-dependent peroxiredoxin activity	IEA
GO:2001057	Process	Reactive nitrogen species metabolic process	IDA	15280035

MIM	HGNC	e!Ensembl
606583	9355	ENSG00000126432

Protein

UniProt ID

P30044

Protein name

Peroxiredoxin-5, mitochondrial (EC 1.11.1.24) (Alu corepressor 1) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 71B) (PLP) (Peroxiredoxin V) (Prx-V) (Peroxisomal antioxidant enzyme) (TPx type VI) (Thioredoxin peroxidase PMP20) (Thioredoxi

Protein function

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrog

PDB

1H4O , 1HD2 , 1OC3 , 1URM , 2VL2 , 2VL3 , 2VL9 , 3MNG , 4K7I , 4K7N , 4K7O , 4MMM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08534	Redoxin	57 → 211	Redoxin	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10521424}.

Sequence

MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGD
AIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGV
QVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKR
FSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

Sequence length

214

Interactions

View interactions

	KEGG		Reactome
	Peroxisome		Detoxification of Reactive Oxygen Species TP53 Regulates Metabolic Genes

Show/Hide Unknown Diseases (11)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alopecia Areata	Alopecia areata	N/A	N/A	GWAS
Biliary Cirrhosis	Primary biliary cirrhosis	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Psoriasis vulgaris	Psoriasis vulgaris	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS
Sarcoidosis	Sarcoidosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (53)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	10833265, 9177183
Adrenocortical Carcinoma	Associate	20231622
Alopecia Areata	Associate	20596022
Aneurysm	Associate	37445606
Aortic Aneurysm Thoracic	Associate	32273946, 37445606
Arthritis Rheumatoid	Associate	10555039
Autistic Disorder	Associate	22051046
Breast Neoplasms	Associate	19620238, 22975630, 33768386, 9774665
Carcinoma Adenoid Cystic	Associate	26847304
Carcinoma Non Small Cell Lung	Stimulate	31899687
Carcinoma Non Small Cell Lung	Associate	33416106
Colorectal Neoplasms	Associate	22294162, 36935009
Congenital Hereditary and Neonatal Diseases and Abnormalities	Stimulate	38057357
Crohn Disease	Associate	31852111
Diabetic Nephropathies	Associate	40076459
Fetal Alcohol Spectrum Disorders	Associate	39359128
Gallbladder Neoplasms	Associate	22882193
Hermanski Pudlak Syndrome	Associate	3346559
Hypoxia	Stimulate	19016754
Hypoxia	Inhibit	36935009
Hypoxia Brain	Associate	36935009
Inflammation	Stimulate	19077163
Kidney Diseases	Associate	38057357
Kidney Diseases Cystic	Associate	38057357
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	31828114
Liver Diseases	Associate	38057357
Liver Failure	Associate	38057357
Loeys Dietz Syndrome	Associate	32273946
Lung Neoplasms	Associate	33416106
Lymphatic Metastasis	Associate	33416106
Lymphoma	Associate	31852111
Marfan Syndrome	Associate	37445606
Melanoma	Associate	19383853
Mitochondrial Diseases	Associate	29959620
Multiple Myeloma	Associate	26795735
Multiple Organ Failure	Associate	39359128
Neoplasm Metastasis	Associate	22481283
Neoplasms	Associate	12744469, 21443269, 22294162, 22882193, 23342042, 24413150, 25906293, 27863422, 30756364, 31541631
Neoplasms	Stimulate	19077163
Neoplasms	Inhibit	36935009
Osteoarthritis	Stimulate	12417342
Ovarian Neoplasms	Associate	23696862, 30104402, 30756364
Prostatic Neoplasms	Associate	21031435, 23133653, 28069826
Pulmonary Fibrosis	Associate	37944440
Radiation Injuries	Associate	33768386
Renal Insufficiency Chronic	Stimulate	35325889
Rhabdomyosarcoma	Associate	28981107
Sleep Deprivation	Associate	23440187
Stomach Neoplasms	Associate	28423550, 31280208
Tuberculosis	Associate	31852111
Tuberous Sclerosis	Associate	37443747
Uterine Cervical Neoplasms	Associate	26758418
Varicocele	Stimulate	23603921

PRDX5 (peroxiredoxin 5)