Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25819
Gene name	Nocturnin
Gene symbol	NOCT
Synonyms (NCBI Gene)	CCR4LCCRN4LCcr4cNOC
Chromosome	4
Chromosome location	4q31.1
Summary	The protein encoded by this gene is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbo

Show/Hide all (39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT740740	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT740741	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT740742	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT740743	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT740744	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT740745	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT740746	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT740747	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT740748	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT740749	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT740750	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT740751	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT740752	hsa-miR-302e	HITS-CLIP	23313552
MIRT740753	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT740754	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT740755	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT740756	hsa-miR-520b	HITS-CLIP	23313552
MIRT740757	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT740758	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT740759	hsa-miR-520e	HITS-CLIP	23313552
MIRT740760	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT740761	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT740762	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT740763	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT740764	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT740765	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT740766	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT754414	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT754415	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT754416	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT754417	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT754418	hsa-miR-4522	PAR-CLIP	21572407
MIRT754419	hsa-miR-3135a	PAR-CLIP	21572407
MIRT754420	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT754421	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT754422	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT754423	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT754424	hsa-miR-6510-3p	PAR-CLIP	21572407
MIRT754790	hsa-miR-3121-3p	PAR-CLIP	22291592

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000175	Function	3'-5'-RNA exonuclease activity	IBA
GO:0000290	Process	Deadenylation-dependent decapping of nuclear-transcribed mRNA	IEA
GO:0000932	Component	P-body	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IEA
GO:0003729	Function	MRNA binding	ISS
GO:0003824	Function	Catalytic activity	IEA
GO:0004535	Function	Poly(A)-specific ribonuclease activity	IEA
GO:0004535	Function	Poly(A)-specific ribonuclease activity	ISS
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	10521507
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	31147539
GO:0005739	Component	Mitochondrion	IEA
GO:0006139	Process	Nucleobase-containing compound metabolic process	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10521507
GO:0006739	Process	NADP+ metabolic process	IDA	31147539
GO:0007623	Process	Circadian rhythm	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IEA
GO:0019178	Function	NADP phosphatase activity	IDA	31147539
GO:0019178	Function	NADP phosphatase activity	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033962	Process	P-body assembly	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	ISS
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048255	Process	MRNA stabilization	IEA
GO:0048255	Process	MRNA stabilization	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0102757	Function	NADPH phosphatase activity	IDA	31147539
GO:0102757	Function	NADPH phosphatase activity	IEA

MIM	HGNC	e!Ensembl
608468	14254	ENSG00000151014

Q9UK39

Protein name

Nocturnin (EC 3.1.3.108) (Carbon catabolite repression 4-like protein)

Protein function

Phosphatase which catalyzes the conversion of NADP(+) to NAD(+) and of NADPH to NADH (PubMed:31147539). Shows a small preference for NADPH over NADP(+) (PubMed:31147539). Represses translation and promotes degradation of target mRNA molecules (P

PDB

6BT1 , 6BT2 , 6MAL , 6NF0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03372	Exo_endo_phos	146 → 414	Endonuclease/Exonuclease/phosphatase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Adipose tissue. Expression is higher in subcutaneous adipose tissue as compared to visceral adipose tissue. {ECO:0000269|PubMed:22331129}.

Sequence

MFHSPRRLCSALLQRDAPGLRRLPAPGLRRPLSPPAAVPRPASPRLLAAASAASGAARSC
SRTVCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHT
RPPRFQRDFVDLRTDCPSTHPPIRVMQWNILAQALGEGKDNFVQCPVEALKWEERKCLIL
EEILAYQPDILCLQEVDHYFDTFQPLLSRLGYQGTFFPKPWSPCLDVEHNNGPDGCALFF
LQNRFKLVNSANIRLTAMTLKTNQVAIAQTLECKESGRQFCIAVTHLKARTGWERFRSAQ
GCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNSAYKLLSADGQSEPP
YTTWKIRTSGECRHTLDYIWYSKHALNVRSALDLLTEEQIGPNRLPSFNYPSDHLSLVCD
FSFTEESDGLS

Sequence length

431

Interactions

View interactions

	Reactome
			BMAL1:CLOCK,NPAS2 activates circadian gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	25114068	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	26541675	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	33022137	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	26541675	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Associate	31467910	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	26541675	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	23922759	★★★★★ ★☆☆☆☆ Found in Text Mining only

NOCT (nocturnin)