Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2581
Gene name Gene Name - the full gene name approved by the HGNC.
Galactosylceramidase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GALC
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q31.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs11623 C>A,G,T Pathogenic Intron variant, upstream transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs11300320 AA>-,A,AAA Likely-benign, benign, uncertain-significance, likely-pathogenic Intron variant
rs34134328 G>A,C Conflicting-interpretations-of-pathogenicity, benign-likely-benign, benign Coding sequence variant, missense variant
rs121908010 C>A Pathogenic Stop gained, coding sequence variant
rs138577661 A>G Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT053631 hsa-let-7f-5p Microarray 22942087
MIRT664804 hsa-miR-548c-3p HITS-CLIP 23824327
MIRT649811 hsa-miR-3606-3p HITS-CLIP 23824327
MIRT649810 hsa-miR-513a-3p HITS-CLIP 23824327
MIRT649809 hsa-miR-513c-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004336 Function Galactosylceramidase activity IBA
GO:0004336 Function Galactosylceramidase activity IDA 8281145, 8399327
GO:0004336 Function Galactosylceramidase activity IEA
GO:0004336 Function Galactosylceramidase activity ISS
GO:0004336 Function Galactosylceramidase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606890 4115 ENSG00000054983
Protein
UniProt ID P54803
Protein name Galactocerebrosidase (GALCERase) (EC 3.2.1.46) (Galactocerebroside beta-galactosidase) (Galactosylceramidase) (Galactosylceramide beta-galactosidase)
Protein function Hydrolyzes the galactose ester bonds of glycolipids such as galactosylceramide and galactosylsphingosine (PubMed:8281145, PubMed:8399327). Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02057 Glyco_hydro_59 55 349 Glycosyl hydrolase family 59 Family
PF17387 Glyco_hydro_59M 357 473 Glycosyl hydrolase family 59 central domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in urine. Detected in testis, brain and placenta (at protein level). Detected in kidney and liver. {ECO:0000269|PubMed:8399327}.
Sequence
MAEWLLSASWQRRAKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIV
GAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLD
AELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQ
FTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEI
PELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGR
KGSYPLP
PKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPIT
WAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIF
ANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFTSGMLNDKSLWTDIPVNFPK
NGWAAIGTHSFEFAQFDNFLVEATR
Sequence length 685
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Sphingolipid metabolism
Metabolic pathways
Lysosome
  Glycosphingolipid metabolism
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Beta-Galactosidase Deficiency Galactosylceramide beta-galactosidase deficiency rs1057517082, rs387906953, rs780750448, rs1240965365, rs1555384335, rs1057516632, rs750524447, rs756352952, rs1555384381, rs1182103005, rs1009872980, rs1057517372, rs2139956292, rs1884498480, rs959445153
View all (95 more)
N/A
Fabry disease fabry disease rs1886145312 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast cancer Breast cancer N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease, Inflammatory bowel disease (MTAG) N/A N/A GWAS
Mental retardation intellectual disability N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atrophy Associate 32677356
Attention Deficit Disorder with Hyperactivity Associate 32661301
Carcinoma Non Small Cell Lung Associate 29758927
Cognitive Dysfunction Associate 28825628
Creutzfeldt Jakob Syndrome Inhibit 30009661
Demyelinating Diseases Associate 24297913, 31185936, 36113749, 36983059
Gaucher Disease Inhibit 35662258
Genetic Diseases Inborn Associate 22073273, 24297913
Glaucoma Open Angle Associate 22073273, 25414181
Glycogen Storage Disease Type II Associate 35662258