Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25802
Gene name Gene Name - the full gene name approved by the HGNC.
Leiomodin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LMOD1
Synonyms (NCBI Gene) Gene synonyms aliases
1D, 64kD, D1, MMIHS3, SM-LMOD, SMLMOD
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression o
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs777696417 G>A,C Pathogenic Coding sequence variant, stop gained, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018126 hsa-miR-335-5p Microarray 18185580
MIRT1111967 hsa-miR-1253 CLIP-seq
MIRT1111968 hsa-miR-1271 CLIP-seq
MIRT1111969 hsa-miR-1291 CLIP-seq
MIRT1111970 hsa-miR-1293 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0005523 Function Tropomyosin binding IBA
GO:0005523 Function Tropomyosin binding IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602715 6647 ENSG00000163431
Protein
UniProt ID P29536
Protein name Leiomodin-1 (64 kDa autoantigen 1D) (64 kDa autoantigen 1D3) (64 kDa autoantigen D1) (Leiomodin, muscle form) (Smooth muscle leiomodin) (SM-Lmod) (Thyroid-associated ophthalmopathy autoantigen)
Protein function Required for proper contractility of visceral smooth muscle cells (PubMed:28292896). Mediates nucleation of actin filaments.
PDB 4Z79 , 4Z8G , 4Z94
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03250 Tropomodulin 6 121 Tropomodulin Family
PF02205 WH2 571 600 WH2 motif Family
Tissue specificity TISSUE SPECIFICITY: Detected in lung vascular smooth muscle (at protein level) (PubMed:27144530). Detected in thyroid and extraocular smooth muscle, but not skeletal muscle (PubMed:2026759). Detected in heart, aorta, skeletal muscle, colon, urinary bladde
Sequence
MSRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQST
GVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSD
L
GKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEE
RAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGERRNTDTRKEGEKMK
RAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKNEPLHEKEAKDDSKTKTPEKQTPSGPT
KPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFTEALEFNTV
VKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL
RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQ
EQRQAQEAKGEKKDLLEVPKAGAVAKGSPKPSPQPSPKPSPKNSPKKGGAPAAPPPPPPP
LAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ
Sequence length 600
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytoskeleton in muscle cells   Smooth Muscle Contraction
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Megacystis-Microcolon-Intestinal Hypoperistalsis Syndrome Megacystis-microcolon-intestinal hypoperistalsis syndrome 3 rs777696417 N/A
Visceral Myopathy Visceral myopathy 1 rs777696417 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aortic Aneurysm Abdominal Associate 34852854
Arteriosclerosis Associate 36292702
Atherosclerosis Associate 36292702
Colorectal Neoplasms Associate 30786729
Coronary Artery Disease Associate 27386823
Fanconi Anemia Associate 23285130
Fibrous Dysplasia Polyostotic Associate 18349068
Glomerulonephritis Membranous Associate 37511514
Leiomyosarcoma Associate 25896974
Leiomyosarcoma Stimulate 28893210