Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	25797
Gene name Gene Name - the full gene name approved by the HGNC.	Glutaminyl-peptide cyclotransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	QPCT
Synonyms (NCBI Gene) Gene synonyms aliases	GCT, QC, sQC
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p22.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided b

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT569640	hsa-miR-7854-3p	PAR-CLIP	20371350
MIRT569639	hsa-miR-3689d	PAR-CLIP	20371350
MIRT569638	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT569637	hsa-miR-363-5p	PAR-CLIP	20371350
MIRT569636	hsa-miR-6745	PAR-CLIP	20371350
MIRT569635	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT569634	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT569640	hsa-miR-7854-3p	PAR-CLIP	20371350
MIRT569639	hsa-miR-3689d	PAR-CLIP	20371350
MIRT569638	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT569637	hsa-miR-363-5p	PAR-CLIP	20371350
MIRT569636	hsa-miR-6745	PAR-CLIP	20371350
MIRT569635	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT569634	hsa-miR-7847-3p	PAR-CLIP	20371350

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IDA	21288892
GO:0016603	Function	Glutaminyl-peptide cyclotransferase activity	IBA
GO:0016603	Function	Glutaminyl-peptide cyclotransferase activity	IDA	21288892
GO:0016603	Function	Glutaminyl-peptide cyclotransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0017186	Process	Peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase	IDA	21288892
GO:0035580	Component	Specific granule lumen	TAS
GO:0036211	Process	Protein modification process	TAS	7999256
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
607065	9753	ENSG00000115828

Protein

UniProt ID

Q16769

Protein name

Glutaminyl-peptide cyclotransferase (EC 2.3.2.5) (Glutaminyl cyclase) (QC) (sQC) (Glutaminyl-tRNA cyclotransferase) (Glutamyl cyclase) (EC)

Protein function

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-termin

PDB

2AFM , 2AFO , 2AFS , 2AFU , 2AFW , 2AFX , 2AFZ , 2ZED , 2ZEE , 2ZEF , 2ZEG , 2ZEH , 2ZEL , 2ZEM , 2ZEN , 2ZEO , 2ZEP , 3PBB , 3PBE , 3SI0 , 4YU9 , 4YWY , 6GBX , 6YI1 , 6YJY , 7CM0 , 7COZ , 7CP0 , 7D8E , 8HY3 , 8XGB , 8XGT , 8XGY , 9ISD , 9IVV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04389	Peptidase_M28	122 → 355	Peptidase family M28	Family

Sequence

MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGT
SISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSF
SNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLS
LKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHG
MDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYG
GVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLH
L

Sequence length

361

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Lymphocytic Leukemia	Chronic lymphocytic leukemia	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Kidney Injury	Associate	33863396
Alzheimer Disease	Associate	22970285, 23977104, 26249687, 28587659, 32614980
Arthritis Rheumatoid	Associate	30399509, 34177888
Bone Diseases	Associate	15231017
Cognition Disorders	Associate	24164736
COVID 19	Associate	38538269
Heart Failure	Associate	35945262
Hypertension	Associate	39596173
Leukemia Myeloid Acute	Associate	37381175
Lupus Erythematosus Systemic	Associate	39290707
Moyamoya Disease	Associate	39290707
Muscular Dystrophy Duchenne	Associate	15231017
Neurodegenerative Diseases	Associate	26249687
Osteoporosis	Associate	15231017
Periodontitis	Associate	30399509
Shock Septic	Associate	33863396
Sleep Deprivation	Associate	38538269

QPCT (glutaminyl-peptide cyclotransferase)