QPCT (glutaminyl-peptide cyclotransferase)

Gene

• Entrez ID: 25797
• Gene name: Glutaminyl-peptide cyclotransferase
• Gene symbol: QPCT
• Synonyms (NCBI Gene): GCT, QC, sQC
• Chromosome: 2
• Chromosome location: 2p22.2
• Summary: This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT569640	hsa-miR-7854-3p	PAR-CLIP	20371350
MIRT569639	hsa-miR-3689d	PAR-CLIP	20371350
MIRT569638	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT569637	hsa-miR-363-5p	PAR-CLIP	20371350
MIRT569636	hsa-miR-6745	PAR-CLIP	20371350
MIRT569635	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT569634	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT569640	hsa-miR-7854-3p	PAR-CLIP	20371350
MIRT569639	hsa-miR-3689d	PAR-CLIP	20371350
MIRT569638	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT569637	hsa-miR-363-5p	PAR-CLIP	20371350
MIRT569636	hsa-miR-6745	PAR-CLIP	20371350
MIRT569635	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT569634	hsa-miR-7847-3p	PAR-CLIP	20371350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IDA	21288892
GO:0016603	Function	Glutaminyl-peptide cyclotransferase activity	IBA
GO:0016603	Function	Glutaminyl-peptide cyclotransferase activity	IDA	21288892
GO:0016603	Function	Glutaminyl-peptide cyclotransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0017186	Process	Peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase	IDA	21288892
GO:0035580	Component	Specific granule lumen	TAS
GO:0036211	Process	Protein modification process	TAS	7999256
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 607065
• HGNC: 9753
• e!Ensembl: ENSG00000115828

Protein

• UniProt ID: Q16769
• Protein name: Glutaminyl-peptide cyclotransferase (EC 2.3.2.5) (Glutaminyl cyclase) (QC) (sQC) (Glutaminyl-tRNA cyclotransferase) (Glutamyl cyclase) (EC)
• Protein function: Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-termin
• PDB: 2AFM, 2AFO, 2AFS, 2AFU, 2AFW, 2AFX, 2AFZ, 2ZED, 2ZEE, 2ZEF, 2ZEG, 2ZEH, 2ZEL, 2ZEM, 2ZEN, 2ZEO, 2ZEP, 3PBB, 3PBE, 3SI0, 4YU9, 4YWY, 6GBX, 6YI1, 6YJY, 7CM0, 7COZ, 7CP0, 7D8E, 8HY3, 8XGB, 8XGT, 8XGY, 9ISD, 9IVV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04389	Peptidase_M28	122 → 355	Peptidase family M28	Family

• Sequence:

  MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGT
  SISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSF
  SNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLS
  LKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHG
  MDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYG
  GVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLH
  L

• Sequence length: 361

Pathways

Reactome:

Neutrophil degranulation