Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25793
Gene name Gene Name - the full gene name approved by the HGNC.
F-box protein 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXO7
Synonyms (NCBI Gene) Gene synonyms aliases
FBX, FBX07, FBX7, PARK15, PKPS
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs34316445 G>C,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant
rs71799110 C>G,T Pathogenic Coding sequence variant, missense variant
rs121918304 C>A,T Pathogenic Coding sequence variant, synonymous variant, stop gained
rs121918305 C>T Pathogenic 5 prime UTR variant, genic upstream transcript variant, upstream transcript variant, missense variant, coding sequence variant
rs730880272 G>T Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023257 hsa-miR-122-5p Microarray 17612493
MIRT037372 hsa-miR-877-5p CLASH 23622248
MIRT440651 hsa-miR-127-5p HITS-CLIP 24374217
MIRT440651 hsa-miR-127-5p HITS-CLIP 24374217
MIRT992950 hsa-miR-2278 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IDA 23933751
GO:0000151 Component Ubiquitin ligase complex TAS 10531035
GO:0000422 Process Autophagy of mitochondrion IMP 23933751
GO:0004842 Function Ubiquitin-protein transferase activity TAS 10531035
GO:0005515 Function Protein binding IPI 15145941, 16278047, 21378169, 22632967, 23933751, 25029497, 25416956, 25910212, 26496610, 27705803, 28514442, 31515488, 32814053, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605648 13586 ENSG00000100225
Protein
UniProt ID Q9Y3I1
Protein name F-box only protein 7
Protein function Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins and plays a role in several biological processes s
PDB 4L9C , 4L9H
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11566 PI31_Prot_N 188 322 PI31 proteasome regulator N-terminal Family
PF00646 F-box 330 377 F-box domain Domain
Sequence
MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDE
ETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQP
SDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVP
HSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMH
PLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKD
LQKLSRLFKDQLVYPLLAFTRQ
ALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCR
DLFTASNDPLLWRFLYL
RDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTH
TIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRP
RFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
Sequence length 522
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Parkinsonian-Pyramidal Syndrome parkinsonian-pyramidal syndrome rs1228608709, rs1290655316, rs749534144, rs749019340, rs71799110, rs121918304, rs730880272, rs121918305 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Parkinson disease Parkinson Disease, Recessive N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ataxia Associate 36233161
Carcinogenesis Associate 37344480
Carcinoma Hepatocellular Associate 15145941
Carcinoma Non Small Cell Lung Associate 26245297
Cardiomyopathies Associate 38291374
Chromosomal Instability Inhibit 34791250
Cognition Disorders Associate 20669327, 20853184
Colorectal Neoplasms Inhibit 34791250
Depressive Disorder Associate 15145941
Dystonia Dopa responsive Associate 20669327