CIZ1 (CDKN1A interacting zinc finger protein 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25792
Gene name Gene Name - the full gene name approved by the HGNC.
CDKN1A interacting zinc finger protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CIZ1
Synonyms (NCBI Gene) Gene synonyms aliases
LSFR1, NP94, ZNF356
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.11
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a zinc finger DNA binding protein that interacts with CIP1, part of a complex with cyclin E. The encoded protein may regulate the cellular localization of CIP1. Several transcript variants encoding different isoforms ha
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(16)
miRTarBase ID miRNA Experiments Reference
MIRT052245 hsa-let-7b-5p CLASH 23622248
MIRT051724 hsa-let-7d-5p CLASH 23622248
MIRT050670 hsa-miR-18a-5p CLASH 23622248
MIRT043659 hsa-miR-326 CLASH 23622248
MIRT043659 hsa-miR-326 CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0005515 Function Protein binding IPI 18654987
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 23145069
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
611420 16744 ENSG00000148337
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9ULV3
Protein name Cip1-interacting zinc finger protein (CDKN1A-interacting zinc finger protein 1) (Nuclear protein NP94) (Zinc finger protein 356)
Protein function May regulate the subcellular localization of CIP/WAF1.
PDB 7X39
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12171 zf-C2H2_jaz 684 → 710 Zinc-finger double-stranded RNA-binding Family
Sequence 
MFSQQQQQQLQQQQQQLQQLQQQQLQQQQLQQQQLLQLQQLLQQSPPQAPLPMAVSRGLP
PQQPQQPLLNLQGTNSASLLNGSMLQRALLLQQLQGLDQFAMPPATYDTAGLTMPTATLG
NLRGYGMASPGLAAPSLTPPQLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQFNLSGRN
PQKQARTSSSTTPNRKDSSSQTMPVEDKSDPPEGSEEAAEPRMDTPEDQDLPPCPEDIAK
EKRTPAPEPEPCEASELPAKRLRSSEEPTEKEPPGQLQVKAQPQARMTVPKQTQTPDLLP
EALEAQVLPRFQPRVLQVQAQVQSQTQPRIPSTDTQVQPKLQKQAQTQTSPEHLVLQQKQ
VQPQLQQEAEPQKQVQPQVQPQAHSQGPRQVQLQQEAEPLKQVQPQVQPQAHSQPPRQVQ
LQLQKQVQTQTYPQVHTQAQPSVQPQEHPPAQVSVQPPEQTHEQPHTQPQVSLLAPEQTP
VVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPG
VWGAGGSLKVTILQSSDSRAFSTVPLTPVPRPSDSVSSTPAATSTPSKQALQFFCYICKA
SCSSQQEFQDHMSEPQHQQRLGEIQHMSQACLLSLLPVPRDVLETEDEEPPPRRWCNTCQ
LYYMGDLIQHRRTQDHKIAKQSLRPFCTVCNRYFKTPRKFVEHVKSQGHKDKAKELKSLE
KEIAGQDEDHFITVDAVGCFEGDEEEEEDDEDEEEIEVEEELCKQVRSRDISREEWKGSE
TYSPNTAYGVDFLVPVMGYICRICHKFYHSNSGAQLSHCKSLGHFENLQKYKAAKNPSPT
TRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKVTARPSQPPLPRRSTRLKT
Sequence length 898
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dystonia Dystonic disorder, Dystonia, primary cervical, inherited dystonia N/A N/A ClinVar, GenCC
Show/Hide Text Mining Associations (13)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 40067149
Carcinogenesis Associate 25427641
Carcinoma Hepatocellular Associate 26906552
Carcinoma Non Small Cell Lung Associate 32196604
Dystonia Associate 35041927
Dystonia musculorum deformans type 1 Associate 23222958
Dystonic Disorders Associate 23449625
Gallbladder Neoplasms Stimulate 25427641
Hemangioma Stimulate 30456533
Lung Neoplasms Associate 20831784, 30107825