Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25780
Gene name Gene Name - the full gene name approved by the HGNC.
RAS guanyl releasing protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RASGRP3
Synonyms (NCBI Gene) Gene synonyms aliases
GRP3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p22.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers. [provided by RefSeq, Mar 2017]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030769 hsa-miR-21-5p Microarray 18591254
MIRT662171 hsa-miR-4438 HITS-CLIP 23824327
MIRT654441 hsa-miR-5588-3p HITS-CLIP 23824327
MIRT662170 hsa-miR-3155a HITS-CLIP 23824327
MIRT662169 hsa-miR-3155b HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
CREB5 Repression 21132541
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade NAS 10934204
GO:0005085 Function Guanyl-nucleotide exchange factor activity IBA
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005085 Function Guanyl-nucleotide exchange factor activity TAS
GO:0005096 Function GTPase activator activity IDA 10934204
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609531 14545 ENSG00000152689
Protein
UniProt ID Q8IV61
Protein name Ras guanyl-releasing protein 3 (Calcium and DAG-regulated guanine nucleotide exchange factor III) (Guanine nucleotide exchange factor for Rap1)
Protein function Guanine nucleotide exchange factor (GEF) for Ras and Rap1.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00617 RasGEF 155 331 RasGEF domain Family
PF00130 C1_1 495 546 Phorbol esters/diacylglycerol binding domain (C1 domain) Domain
Sequence
MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMH
QLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRR
FARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRV
HAGVDVVDRGTEFELDQDEGEETRQDGEDG
Sequence length 690
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
B cell receptor signaling pathway
Pathways in cancer
  Activation of RAS in B cells
RAF/MAP kinase cascade
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lip and Oral Cavity Carcinoma lip and oral cavity carcinoma N/A N/A ClinVar
Sjogren-Larsson Syndrome Sjogren-Larsson Syndrome N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 24890784
Arthritis Rheumatoid Stimulate 26714738
Colorectal Neoplasms Associate 37013584
Diabetes Mellitus Associate 19421330
Diabetes Mellitus Type 1 Associate 20736230
Glioblastoma Associate 25682201
Glioma Associate 25682201
Hypertension Associate 19421330
Lupus Erythematosus Systemic Associate 20736230
Medulloblastoma Associate 28545823