Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25777
Gene name Gene Name - the full gene name approved by the HGNC.
Sad1 and UNC84 domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SUN2
Synonyms (NCBI Gene) Gene synonyms aliases
UNC84B, rab5IP
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a `bridge` across the nuclear envelope, known as the LINC complex, via interaction with the conserved luminal KAS
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020123 hsa-miR-130b-3p Sequencing 20371350
MIRT027033 hsa-miR-103a-3p Sequencing 20371350
MIRT050037 hsa-miR-27a-3p CLASH 23622248
MIRT047952 hsa-miR-30c-5p CLASH 23622248
MIRT046749 hsa-miR-222-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000781 Component Chromosome, telomeric region IEA
GO:0000794 Component Condensed nuclear chromosome IEA
GO:0005515 Function Protein binding IPI 18396275, 19933576, 20551905, 21391237, 21988832, 22555292, 22632968, 25416956, 26496610, 28514442, 30833792, 31980649, 32353859, 33058875, 33060197, 33393904, 33961781, 35311970, 36217030
GO:0005521 Function Lamin binding IDA 19933576
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613569 14210 ENSG00000100242
Protein
UniProt ID Q9UH99
Protein name SUN domain-containing protein 2 (Protein unc-84 homolog B) (Rab5-interacting protein) (Rab5IP) (Sad1/unc-84 protein-like 2)
Protein function As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role
PDB 3UNP , 4DXR , 4DXS , 4DXT , 4FI9 , 6WMD , 6WME , 6WMF , 6WMG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18580 HTH_SUN2 481 538 SUN2 helix-turn-helix domain Domain
PF07738 Sad1_UNC 581 715 Sad1 / UNC-like C-terminal Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in heart, lung and muscle. Weakly expressed in fetal heart. Slightly overexpressed in some heart tissues form patients with congenital heart defects. {ECO:0000269|PubMed:10818110, ECO:0000269|PubMed:1
Sequence
MSRRSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNMKRLSPAPQLG
PSSDAHTSYYSESLVHESWFPPRSSLEELHGDANWGEDLRVRRRRGTGGSESSRASGLVG
RKATEDFLGSSSGYSSEDDYVGYSDVDQQSSSSRLRSAVSRAGSLLWMVATSPGRLFRLL
YWWAGTTWYRLTTAASLLDVFVLTRRFSSLKTFLWFLLPLLLLTCLTYGAWYFYPYGLQT
FHPALVSWWAAKDSRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQK
EAMRLERLELRQGAPGQGGGGGLSHEDTLALLEGLVSRREAALKEDFRRETAARIQEELS
ALRAEHQQDSEDLFKKIVRASQESEARIQQLKSEWQSMTQESFQESSVKELRRLEDQLAG
LQQELAALALKQSSVAEEVGLLPQQIQAVRDDVESQFPAWISQFLARGGGGRVGLLQREE
MQAQLRELESKILTHVAEMQGKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYS
EDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGN
CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGT
LLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGEP
AH
Sequence length 717
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Cytoskeleton in muscle cells  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
emery-dreifuss muscular dystrophy Emery-Dreifuss muscular dystrophy N/A N/A ClinVar
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Inhibit 26175118
Charcot Marie Tooth Disease Associate 22555292
Charcot Marie Tooth disease Type 2B Associate 22555292
HIV Infections Associate 26865710
HIV Infections Inhibit 28077629, 34592156
HTLV I Infections Associate 28747499
Infections Associate 28077629
Leukemia Lymphoma Adult T Cell Associate 26865710
Lung Neoplasms Inhibit 26658802
Lymphoma Non Hodgkin Stimulate 17827388