GPX6 (glutathione peroxidase 6)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
257202
Gene name Gene Name - the full gene name approved by the HGNC.
Glutathione peroxidase 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPX6
Synonyms (NCBI Gene) Gene synonyms aliases
GPX5p, GPXP3, GPx-6, GSHPx-6, dJ1186N24, dJ1186N24.1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozy
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(434)
miRTarBase ID miRNA Experiments Reference
MIRT610705 hsa-miR-8485 HITS-CLIP 19536157
MIRT610710 hsa-miR-329-3p HITS-CLIP 19536157
MIRT610709 hsa-miR-362-3p HITS-CLIP 19536157
MIRT610705 hsa-miR-8485 HITS-CLIP 23313552
MIRT610710 hsa-miR-329-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0004601 Function Peroxidase activity IEA
GO:0004602 Function Glutathione peroxidase activity IBA
GO:0004602 Function Glutathione peroxidase activity IEA
GO:0005576 Component Extracellular region IEA
GO:0006979 Process Response to oxidative stress IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
607913 4558 ENSG00000198704
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P59796
Protein name Glutathione peroxidase 6 (GPx-6) (GSHPx-6) (EC 1.11.1.9)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00255 GSHPx 40 → 153 Glutathione peroxidase Family
Tissue specificity TISSUE SPECIFICITY: Expressed in olfactory epithelium and embryos. {ECO:0000269|PubMed:12775843}.
Sequence 
MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYGALTLNGEEYIQFKQFA
GKHVLFVNVAAYUGLAAQYPELNALQEELKNFGVIVLAFPCNQFGKQEPGTNSEILLGLK
YVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDIR
WNFEKFLVGPDGVPVMHWFHQAPVSTVKSDILEYLKQFNTH
Sequence length 221
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases 		  Detoxification of Reactive Oxygen Species
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Cervical Cancer Cervical cancer N/A N/A GWAS
Ovarian cancer Epithelial ovarian cancer N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 25416100
Breast Neoplasms Stimulate 25416100
Diabetes Mellitus Type 2 Associate 34545296
Diabetic Nephropathies Associate 34545296