PLCXD2 (phosphatidylinositol specific phospholipase C X domain containing 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
257068
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphatidylinositol specific phospholipase C X domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLCXD2
Synonyms (NCBI Gene) Gene synonyms aliases
PLCXD-2
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(57)
miRTarBase ID miRNA Experiments Reference
MIRT023634 hsa-miR-1-3p Proteomics 18668040
MIRT031617 hsa-miR-16-5p Proteomics 18668040
MIRT049651 hsa-miR-92a-3p CLASH 23622248
MIRT643138 hsa-miR-4310 HITS-CLIP 23824327
MIRT643137 hsa-miR-7157-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0006629 Process Lipid metabolic process IEA
GO:0007165 Process Signal transduction IEA
GO:0008081 Function Phosphoric diester hydrolase activity IBA
GO:0008081 Function Phosphoric diester hydrolase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617015 26462 ENSG00000240891
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q0VAA5
Protein name PI-PLC X domain-containing protein 2 (Phospholipase C X-domain containing protein 2) (PLCXD-2)
Protein function Catalyzes the hydrolysis of inositol from phosphatidylinositol (1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol), PI) (PubMed:22732399). Could also hydrolyze various multi-phosphorylated derivatives of PI, such as phosphatidylinositol-4,5 bisph
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:22732399}.
Sequence 
MLAVRKARRKLRMGTICSPNPSGTKTSSEVCNADWMASLPPHLHNLPLSNLAIPGSHDSF
SYWVDEKSPVGPDQTQAIKRLARISLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSK
PGDADQEIYFIHGLFGIKVWDGLMEIDSFLTQHPQEIIFLDFNHFYAMDETHHKCLVLRI
QEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSV
RKLILFLETTLSERASRGSFHVSQAILTPRVKTIARGLVGGLKNTLVHSNRWNSHGPSLL
SQERS
Sequence length 305
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Esophageal Squamous Cell Carcinoma Associate 31053115