Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
257019
Gene name Gene Name - the full gene name approved by the HGNC.
FERM domain containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FRMD3
Synonyms (NCBI Gene) Gene synonyms aliases
4.1O, EPB41L4O, EPB41LO, P410
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a single pass membrane protein primarily found in ovaries. A similar protein in erythrocytes helps determine the shape of red blood cells, but the function of the encoded protein has not been determined. There is some e
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022494 hsa-miR-124-3p Microarray 18668037
MIRT541345 hsa-miR-342-3p HITS-CLIP 23824327
MIRT541344 hsa-miR-8485 HITS-CLIP 23824327
MIRT541343 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT542956 hsa-miR-6817-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005856 Component Cytoskeleton IBA
GO:0008092 Function Cytoskeletal protein binding IEA
GO:0016020 Component Membrane IEA
GO:0031032 Process Actomyosin structure organization IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607619 24125 ENSG00000172159
Protein
UniProt ID A2A2Y4
Protein name FERM domain-containing protein 3 (Band 4.1-like protein 4O) (Ovary type protein 4.1) (4.1O)
Protein function Putative tumor suppressor gene that may be implicated in the origin and progression of lung cancer.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09379 FERM_N 36 99 FERM N-terminal domain Domain
PF00373 FERM_M 115 225 FERM central domain Domain
PF09380 FERM_C 229 316 FERM C-terminal PH-like domain Domain
PF08736 FA 323 366 FERM adjacent (FA) Family
Tissue specificity TISSUE SPECIFICITY: Ovary-specific. {ECO:0000269|PubMed:12601556}.
Sequence
MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKT
HPPYTMCFRVKFYPHEPLKIK
EELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFP
KQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPH
PCKDSTGTTTFLGFT
AAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYVIGTQKEKKAMLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQI
KTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRANI
TQSRSS
HSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLPKEENISAPLISSSPVKA
AREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDT
DSFEDLEADENAFLIAEEEELKEARRALSWSYDILTGHIRVNPLVKSFSRLLVVGLGLLL
FVFPLLLLLLESGIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS
Sequence length 597
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer and/or colorectal cancer N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Fibromuscular Dysplasia Fibromuscular dysplasia N/A N/A GWAS
Hypertension Hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 34865205
Breast Neoplasms Inhibit 36631457
Diabetes Mellitus Type 1 Associate 19252134
Diabetes Mellitus Type 2 Associate 21698141, 24551085
Diabetic Nephropathies Associate 19252134, 23434934
Kidney Failure Chronic Associate 21698141, 24551085
Neoplasm Metastasis Inhibit 36631457
Pelvic Organ Prolapse Associate 26347886
Tissue Adhesions Inhibit 36631457