SUN3 (Sad1 and UNC84 domain containing 3)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
256979
Gene name Gene Name - the full gene name approved by the HGNC.
Sad1 and UNC84 domain containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SUN3
Synonyms (NCBI Gene) Gene synonyms aliases
SUNC1
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p12.3
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0005635 Component Nuclear envelope IBA 21873635
GO:0005637 Component Nuclear inner membrane IEA
GO:0006998 Process Nuclear envelope organization IBA 21873635
GO:0016021 Component Integral component of membrane IEA
GO:0034993 Component Meiotic nuclear membrane microtubule tethering complex IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
618984 22429 ENSG00000164744
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8TAQ9
Protein name SUN domain-containing protein 3 (Sad1/unc-84 domain-containing protein 1)
Protein function As a probable component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an impor
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07738 Sad1_UNC 219 → 353 Sad1 / UNC-like C-terminal Family
Sequence 
MSGKTKARRAAMFFRRCSEDASGSASGNALLSEDENPDANGVTRSWKIILSTMLTLTFLL
VGLLNHQWLKETDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNF
RQILFLIEQIDVLKALLRDMKDGMDNNHNWNTHGDPVEDPDHTEEVSNLVNYVLKKLRED
QVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCW
AFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
GQFIYNKTGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTCLYRFRVHGTPGKHI
Sequence length 357
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)		 19193627
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Psoriasis Psoriasis GWAS
Alzheimer disease Alzheimer disease GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 19193627
Papillary Thyroid Microcarcinoma Associate 29263185
Thyroid Neoplasms Associate 29263185