TCERG1L (transcription elongation regulator 1 like)

Gene

• Entrez ID: 256536
• Gene name: Transcription elongation regulator 1 like
• Gene symbol: TCERG1L
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10q26.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1415914	hsa-miR-1	CLIP-seq
MIRT1415915	hsa-miR-1178	CLIP-seq
MIRT1415916	hsa-miR-128	CLIP-seq
MIRT1415917	hsa-miR-206	CLIP-seq
MIRT1415918	hsa-miR-27a	CLIP-seq
MIRT1415919	hsa-miR-27b	CLIP-seq
MIRT1415920	hsa-miR-3673	CLIP-seq
MIRT1415921	hsa-miR-613	CLIP-seq
MIRT1415922	hsa-miR-668	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0005634	Component	Nucleus	IBA
GO:0070063	Function	RNA polymerase binding	IBA
GO:0070063	Function	RNA polymerase binding	IEA

Other IDs

• MIM: 620498
• HGNC: 23533
• e!Ensembl: ENSG00000176769

Protein

• UniProt ID: Q5VWI1
• Protein name: Transcription elongation regulator 1-like protein
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01846	FF	452 → 500	FF domain	Family
  PF01846	FF	518 → 567	FF domain	Family

• Sequence:

  MQAGARFQRRRRQLQQQQPRRRQPLLWPMDAEPPPPPPWVWMVPGSAGLLRLSAGVVVPP
  VLLASAPPPAAPLLPGLPGWPAPSEPVLPLLPLPSAPDSAAAAAAHPFPALHGQWLFGGH
  SPSLGLPPSSTVELVPVFPHLCPSALATPIGKSWIDKRIPNCKIFFNNSFALDSTWIHPE
  ESRFFHGHEKPRLLANQVAVSLSRPAPASRPLPTVVLAPQPIPGGCHNSLKVTSSPAIAI
  ATAAAAAMVSVDPENLRGPSPSSVQPRHFLTLAPIKIPLRTSPVSDTRTERGRVARPPAL
  MLRAQKSRDGDKEDKEPPPMLGGGEDSTARGNRPVASTPVPGSPWCVVWTGDDRVFFFNP
  TMHLSVWEKPMDLKDRGDLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNR
  TEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIV
  FDPRYLLLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKE
  FAEKYGRDQRFRLVQKRKDQEHFFNQFILILKKRDKENRLRLRKMR

• Sequence length: 586

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSHIDROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SAPHO SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	37082886	★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	22238052	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Associate	20732627	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	22238052, 23321599	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Associate	22791750	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	22238052	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23321599	★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Associate	37082886	★☆☆☆☆ Found in Text Mining only
Otitis Media	Associate	24499112	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	29313708	★☆☆☆☆ Found in Text Mining only