TCERG1L (transcription elongation regulator 1 like)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
256536
Gene name Gene Name - the full gene name approved by the HGNC.
Transcription elongation regulator 1 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TCERG1L
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q26.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT1415914 hsa-miR-1 CLIP-seq
MIRT1415915 hsa-miR-1178 CLIP-seq
MIRT1415916 hsa-miR-128 CLIP-seq
MIRT1415917 hsa-miR-206 CLIP-seq
MIRT1415918 hsa-miR-27a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
GO ID Ontology Definition Evidence Reference
GO:0003712 Function Transcription coregulator activity IBA
GO:0005634 Component Nucleus IBA
GO:0070063 Function RNA polymerase binding IBA
GO:0070063 Function RNA polymerase binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
620498 23533 ENSG00000176769
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5VWI1
Protein name Transcription elongation regulator 1-like protein
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01846 FF 452 → 500 FF domain Family
PF01846 FF 518 → 567 FF domain Family
Sequence 
MQAGARFQRRRRQLQQQQPRRRQPLLWPMDAEPPPPPPWVWMVPGSAGLLRLSAGVVVPP
VLLASAPPPAAPLLPGLPGWPAPSEPVLPLLPLPSAPDSAAAAAAHPFPALHGQWLFGGH
SPSLGLPPSSTVELVPVFPHLCPSALATPIGKSWIDKRIPNCKIFFNNSFALDSTWIHPE
ESRFFHGHEKPRLLANQVAVSLSRPAPASRPLPTVVLAPQPIPGGCHNSLKVTSSPAIAI
ATAAAAAMVSVDPENLRGPSPSSVQPRHFLTLAPIKIPLRTSPVSDTRTERGRVARPPAL
MLRAQKSRDGDKEDKEPPPMLGGGEDSTARGNRPVASTPVPGSPWCVVWTGDDRVFFFNP
TMHLSVWEKPMDLKDRGDLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNR
TEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIV
FDPRYLLLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKE
FAEKYGRDQRFRLVQKRKDQEHFFNQFILILKKRDKENRLRLRKMR
Sequence length 586
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Diabetes Type 2 diabetes, Glycaemic response to GLP-1 agonist treatment in type 2 diabetes (HbA1c reduction) N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Show/Hide Text Mining Associations (10)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37082886
Adenoma Associate 22238052
Attention Deficit Disorder with Hyperactivity Associate 20732627
Colorectal Neoplasms Associate 22238052, 23321599
Insulin Resistance Associate 22791750
Neoplasms Inhibit 22238052
Neoplasms Associate 23321599
Oculocerebrorenal Syndrome Associate 37082886
Otitis Media Associate 24499112
Pulmonary Disease Chronic Obstructive Associate 29313708