STEAP1B (STEAP family member 1B)

Gene

• Entrez ID: 256227
• Gene name: STEAP family member 1B
• Gene symbol: STEAP1B
• Synonyms (NCBI Gene): -
• Chromosome: 7
• Chromosome location: 7p15.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1396775	hsa-miR-1207-5p	CLIP-seq
MIRT1396776	hsa-miR-1225-5p	CLIP-seq
MIRT1396777	hsa-miR-193a-3p	CLIP-seq
MIRT1396778	hsa-miR-193b	CLIP-seq
MIRT1396779	hsa-miR-3132	CLIP-seq
MIRT1396780	hsa-miR-3189-3p	CLIP-seq
MIRT1396781	hsa-miR-409-3p	CLIP-seq
MIRT1396782	hsa-miR-4451	CLIP-seq
MIRT1396783	hsa-miR-4736	CLIP-seq
MIRT1396784	hsa-miR-4763-3p	CLIP-seq
MIRT1396785	hsa-miR-892b	CLIP-seq
MIRT1396786	hsa-miR-924	CLIP-seq
MIRT1396775	hsa-miR-1207-5p	CLIP-seq
MIRT1396777	hsa-miR-193a-3p	CLIP-seq
MIRT1396778	hsa-miR-193b	CLIP-seq
MIRT1396783	hsa-miR-4736	CLIP-seq
MIRT1396784	hsa-miR-4763-3p	CLIP-seq
MIRT1396785	hsa-miR-892b	CLIP-seq
MIRT2118849	hsa-miR-1206	CLIP-seq
MIRT1396775	hsa-miR-1207-5p	CLIP-seq
MIRT1396777	hsa-miR-193a-3p	CLIP-seq
MIRT1396778	hsa-miR-193b	CLIP-seq
MIRT2118850	hsa-miR-2467-3p	CLIP-seq
MIRT2118851	hsa-miR-3688-5p	CLIP-seq
MIRT2118852	hsa-miR-4289	CLIP-seq
MIRT2118853	hsa-miR-4474-3p	CLIP-seq
MIRT2118854	hsa-miR-4687-3p	CLIP-seq
MIRT1396783	hsa-miR-4736	CLIP-seq
MIRT1396784	hsa-miR-4763-3p	CLIP-seq
MIRT1396785	hsa-miR-892b	CLIP-seq
MIRT1396775	hsa-miR-1207-5p	CLIP-seq
MIRT1396777	hsa-miR-193a-3p	CLIP-seq
MIRT1396778	hsa-miR-193b	CLIP-seq
MIRT1396783	hsa-miR-4736	CLIP-seq
MIRT1396784	hsa-miR-4763-3p	CLIP-seq
MIRT1396785	hsa-miR-892b	CLIP-seq
MIRT1396775	hsa-miR-1207-5p	CLIP-seq
MIRT1396777	hsa-miR-193a-3p	CLIP-seq
MIRT1396778	hsa-miR-193b	CLIP-seq
MIRT1396783	hsa-miR-4736	CLIP-seq
MIRT1396784	hsa-miR-4763-3p	CLIP-seq
MIRT1396785	hsa-miR-892b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 32814053, 33961781
GO:0005768	Component	Endosome	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6NZ63
• Protein name: STEAP family member 1B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01794	Ferric_reduct	99 → 245	Ferric reductase like transmembrane component	Family

• Sequence:

  MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAA
  VMASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIV
  QVHNGTKYKKFPHWLDKWMLTRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQ
  VQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQVHGRI
  NFLTL

• Sequence length: 245

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Essential Tremor	Associate	36183486	★☆☆☆☆ Found in Text Mining only