SYCE2 (synaptonemal complex central element protein 2)

Gene

• Entrez ID: 256126
• Gene name: Synaptonemal complex central element protein 2
• Gene symbol: SYCE2
• Synonyms (NCBI Gene): CESC1
• Chromosome: 19
• Chromosome location: 19p13.13
• Summary: The protein encoded by this gene is part of the synaptonemal complex formed between homologous chromosomes during meiotic prophase. The encoded protein associates with SYCP1 and SYCE1 and is found only where chromosome cores are synapsed. [provided by Ref

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1405089	hsa-miR-221	CLIP-seq
MIRT1405090	hsa-miR-222	CLIP-seq
MIRT1405091	hsa-miR-3122	CLIP-seq
MIRT1405092	hsa-miR-3652	CLIP-seq
MIRT1405093	hsa-miR-3689a-3p	CLIP-seq
MIRT1405094	hsa-miR-3689c	CLIP-seq
MIRT1405095	hsa-miR-378	CLIP-seq
MIRT1405096	hsa-miR-378b	CLIP-seq
MIRT1405097	hsa-miR-378c	CLIP-seq
MIRT1405098	hsa-miR-378d	CLIP-seq
MIRT1405099	hsa-miR-378e	CLIP-seq
MIRT1405100	hsa-miR-378f	CLIP-seq
MIRT1405101	hsa-miR-378h	CLIP-seq
MIRT1405102	hsa-miR-378i	CLIP-seq
MIRT1405103	hsa-miR-3913-5p	CLIP-seq
MIRT1405104	hsa-miR-422a	CLIP-seq
MIRT1405105	hsa-miR-4430	CLIP-seq
MIRT1405106	hsa-miR-4492	CLIP-seq
MIRT1405107	hsa-miR-4498	CLIP-seq
MIRT1405108	hsa-miR-548v	CLIP-seq
MIRT1405109	hsa-miR-762	CLIP-seq
MIRT2460867	hsa-miR-3151	CLIP-seq
MIRT2460868	hsa-miR-4283	CLIP-seq
MIRT2460869	hsa-miR-4318	CLIP-seq
MIRT2460870	hsa-miR-4447	CLIP-seq
MIRT2460871	hsa-miR-4472	CLIP-seq
MIRT2460872	hsa-miR-4489	CLIP-seq
MIRT2460873	hsa-miR-491-5p	CLIP-seq
MIRT2460874	hsa-miR-548g	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000801	Component	Central element	IBA
GO:0000801	Component	Central element	IEA
GO:0000801	Component	Central element	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005694	Component	Chromosome	ISS
GO:0007130	Process	Synaptonemal complex assembly	IEA
GO:0007130	Process	Synaptonemal complex assembly	NAS	15944401
GO:0051301	Process	Cell division	IEA
GO:0051321	Process	Meiotic cell cycle	IEA

Other IDs

• MIM: 611487
• HGNC: 27411
• e!Ensembl: ENSG00000161860

Protein

• UniProt ID: Q6PIF2
• Protein name: Synaptonemal complex central element protein 2 (Central element synaptonemal complex protein 1)
• Protein function: Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synapto
• PDB: 6R17, 6YQF
• Sequence:

  MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYF
  SSLDSSIDILQKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYND
  HNKIIQEKLQEFTQKMAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGK
  SPPRPGNSQPPDVFVSSVAETTSQATASEVQTNRDGEC

• Sequence length: 218

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Colonic Neoplasms	Associate	38238555	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	38238555	★☆☆☆☆ Found in Text Mining only