Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	255738
Gene name	Proprotein convertase subtilisin/kexin type 9
Gene symbol	PCSK9
Synonyms (NCBI Gene)	FH3FHCL3HCHOLA3LDLCQ1NARC-1NARC1PC9
Chromosome	1
Chromosome location	1p32.3
Summary	This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein under

Show/Hide all (44)

SNP ID	Visualize variation	Clinical significance	Consequence
rs509504	A>C,G,T	Likely-benign, benign, conflicting-interpretations-of-pathogenicity	Non coding transcript variant, synonymous variant, coding sequence variant, missense variant
rs7552471	C>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign, benign	Non coding transcript variant, synonymous variant, missense variant, coding sequence variant
rs11583680	C>G,T	Pathogenic	Missense variant, genic upstream transcript variant, upstream transcript variant, coding sequence variant
rs11800243	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign, benign	Intron variant
rs28362201	G>C,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Genic upstream transcript variant, 5 prime UTR variant, upstream transcript variant
rs28362261	A>G	Benign, benign-likely-benign, likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, non coding transcript variant
rs28362286	C>A,T	Pathogenic, association, benign	Stop gained, coding sequence variant, synonymous variant, non coding transcript variant
rs28362287	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	3 prime UTR variant, non coding transcript variant
rs28385701	C>T	Benign, conflicting-interpretations-of-pathogenicity, likely-benign	Genic upstream transcript variant, coding sequence variant, synonymous variant, upstream transcript variant
rs28385710	C>T	Benign-likely-benign, conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant, non coding transcript variant
rs28942111	T>A	Pathogenic, likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs28942112	T>C	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs35574083	GCTGCTGCT>-,GCT,GCTGCT,GCTGCTGCTGCT,GCTGCTGCTGCTGCT,GCTGCTGCTGCTGCTGCT,GCTGCTGCTGCTGCTGCTGCT,GCTGCTGCTGCTGCTGCTGCTGCT	Benign, benign-likely-benign, likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity	Genic upstream transcript variant, coding sequence variant, inframe deletion, inframe insertion, upstream transcript variant
rs41297883	C>A,T	Benign, conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant, non coding transcript variant
rs67608943	C>G,T	Conflicting-interpretations-of-pathogenicity, association	Stop gained, synonymous variant, coding sequence variant, intron variant
rs137852912	G>A,C,T	Pathogenic-likely-pathogenic, pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs146471967	C>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, non coding transcript variant
rs185392267	C>T	Pathogenic	Coding sequence variant, missense variant, intron variant
rs374603772	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant, non coding transcript variant
rs569379713	C>T	Pathogenic, uncertain-significance	Missense variant, intron variant, coding sequence variant
rs745633457	G>A,T	Pathogenic	Intron variant
rs753857795	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, non coding transcript variant, missense variant
rs761767572	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs764603059	G>T	Pathogenic, uncertain-significance	Upstream transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs768795323	G>A	Uncertain-significance, pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs772677312	C>G	Uncertain-significance, likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs778849441	C>A,G,T	Likely-pathogenic, pathogenic, uncertain-significance	Coding sequence variant, stop gained, missense variant, non coding transcript variant
rs793888521	G>A	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs794728683	G>A,T	Pathogenic, likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs886039839	C>A	Likely-pathogenic	Upstream transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs886046435	G>A,C	Pathogenic, uncertain-significance	Non coding transcript variant, coding sequence variant, missense variant
rs986151799	G>A	Pathogenic	Synonymous variant, coding sequence variant, non coding transcript variant
rs1057519691	T>C,G	Likely-pathogenic, pathogenic	Missense variant, intron variant, coding sequence variant
rs1254346075	G>A,T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1272703401	G>A	Pathogenic	Intron variant, upstream transcript variant, genic upstream transcript variant
rs1278890129	G>A	Pathogenic, uncertain-significance	Upstream transcript variant, coding sequence variant, genic upstream transcript variant, missense variant
rs1372204035	C>G	Pathogenic	Coding sequence variant, missense variant, upstream transcript variant, genic upstream transcript variant
rs1553135400	G>A	Pathogenic	Upstream transcript variant, coding sequence variant, missense variant, genic upstream transcript variant
rs1553135406	C>-	Likely-pathogenic, pathogenic	Upstream transcript variant, frameshift variant, coding sequence variant, genic upstream transcript variant
rs1553135930	A>C	Pathogenic	Intron variant, coding sequence variant, missense variant
rs1553135971	A>G	Likely-pathogenic, uncertain-significance	Intron variant, coding sequence variant, missense variant
rs1553137543	A>T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1553137693	A>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1553137699	G>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant

484

Show/Hide all (484)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018980	hsa-miR-335-5p	Microarray	18185580
MIRT023073	hsa-miR-124-3p	Microarray	18668037
MIRT024487	hsa-miR-215-5p	Microarray	19074876
MIRT026924	hsa-miR-192-5p	Microarray	19074876
MIRT499838	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT499835	hsa-miR-3976	PAR-CLIP	20371350
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	20371350
MIRT499834	hsa-miR-1208	PAR-CLIP	20371350
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	20371350
MIRT499830	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	20371350
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	20371350
MIRT499826	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT499825	hsa-miR-1303	PAR-CLIP	20371350
MIRT499838	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT499835	hsa-miR-3976	PAR-CLIP	20371350
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	20371350
MIRT499834	hsa-miR-1208	PAR-CLIP	20371350
MIRT499833	hsa-miR-1915-3p	PAR-CLIP	20371350
MIRT499831	hsa-miR-6764-5p	PAR-CLIP	20371350
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	20371350
MIRT499830	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	20371350
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	20371350
MIRT499826	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT499825	hsa-miR-1303	PAR-CLIP	20371350
MIRT569930	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT569929	hsa-miR-1912	PAR-CLIP	20371350
MIRT569928	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT569927	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT569926	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT569925	hsa-miR-3174	PAR-CLIP	20371350
MIRT569924	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT569923	hsa-miR-759	PAR-CLIP	20371350
MIRT569922	hsa-miR-6852-5p	PAR-CLIP	20371350
MIRT569921	hsa-miR-4667-5p	PAR-CLIP	20371350
MIRT569919	hsa-miR-4700-5p	PAR-CLIP	20371350
MIRT569920	hsa-miR-8089	PAR-CLIP	20371350
MIRT569918	hsa-miR-765	PAR-CLIP	20371350
MIRT569917	hsa-miR-3612	PAR-CLIP	20371350
MIRT569916	hsa-miR-650	PAR-CLIP	20371350
MIRT569915	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569914	hsa-miR-3175	PAR-CLIP	20371350
MIRT569913	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569912	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569911	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569910	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569909	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569908	hsa-miR-7107-5p	PAR-CLIP	20371350
MIRT499838	hsa-miR-483-5p	PAR-CLIP	21572407
MIRT499837	hsa-miR-1182	PAR-CLIP	21572407
MIRT499835	hsa-miR-3976	PAR-CLIP	21572407
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	21572407
MIRT499834	hsa-miR-1208	PAR-CLIP	21572407
MIRT499833	hsa-miR-1915-3p	PAR-CLIP	21572407
MIRT499831	hsa-miR-6764-5p	PAR-CLIP	21572407
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT499830	hsa-miR-367-5p	PAR-CLIP	21572407
MIRT499829	hsa-miR-193a-5p	PAR-CLIP	21572407
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	21572407
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	21572407
MIRT499826	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT499825	hsa-miR-1303	PAR-CLIP	21572407
MIRT499838	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT499837	hsa-miR-1182	PAR-CLIP	23446348
MIRT499835	hsa-miR-3976	PAR-CLIP	23446348
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT499834	hsa-miR-1208	PAR-CLIP	23446348
MIRT499833	hsa-miR-1915-3p	PAR-CLIP	23446348
MIRT499831	hsa-miR-6764-5p	PAR-CLIP	23446348
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	23446348
MIRT499830	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT499829	hsa-miR-193a-5p	PAR-CLIP	23446348
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT499826	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT499825	hsa-miR-1303	PAR-CLIP	23446348
MIRT499838	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT499835	hsa-miR-3976	PAR-CLIP	23446348
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT499834	hsa-miR-1208	PAR-CLIP	23446348
MIRT499830	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT499826	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT499825	hsa-miR-1303	PAR-CLIP	23446348
MIRT499838	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT499835	hsa-miR-3976	PAR-CLIP	23446348
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT499834	hsa-miR-1208	PAR-CLIP	23446348
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	23446348
MIRT499830	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT499826	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT499825	hsa-miR-1303	PAR-CLIP	23446348
MIRT499838	hsa-miR-483-5p	PAR-CLIP	24398324
MIRT499837	hsa-miR-1182	PAR-CLIP	24398324
MIRT499835	hsa-miR-3976	PAR-CLIP	24398324
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	24398324
MIRT499834	hsa-miR-1208	PAR-CLIP	24398324
MIRT499833	hsa-miR-1915-3p	PAR-CLIP	24398324
MIRT499831	hsa-miR-6764-5p	PAR-CLIP	24398324
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	24398324
MIRT499830	hsa-miR-367-5p	PAR-CLIP	24398324
MIRT499829	hsa-miR-193a-5p	PAR-CLIP	24398324
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	24398324
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	24398324
MIRT499826	hsa-miR-744-3p	PAR-CLIP	24398324
MIRT499825	hsa-miR-1303	PAR-CLIP	24398324
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	23592263
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	23592263
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT459651	hsa-miR-4721	PAR-CLIP	23592263
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT459647	hsa-miR-4656	PAR-CLIP	23592263
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459647	hsa-miR-4656	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459651	hsa-miR-4721	PAR-CLIP	26701625
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	26701625
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	26701625
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	26701625
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	26701625
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	26701625
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	26701625
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	27292025
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	27292025
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	27292025
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	27292025
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	27292025
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	27292025
MIRT459647	hsa-miR-4656	PAR-CLIP	27292025
MIRT459647	hsa-miR-4656	PAR-CLIP	27292025
MIRT459651	hsa-miR-4721	PAR-CLIP	27292025
MIRT459651	hsa-miR-4721	PAR-CLIP	27292025
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	27292025
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	27292025
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	27292025
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	27292025
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	27292025
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	27292025
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	27292025
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	27292025
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	27292025
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	27292025
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	27292025
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	27292025
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	27292025
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	27292025
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	27292025
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	27292025
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	27292025
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	27292025
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	27292025
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT735187	hsa-miR-564	Western blottingqRT-PCR	33899508
MIRT459651	hsa-miR-4721	Luciferase reporter assayWestern blottingqRT-PCR	33899508
MIRT459650	hsa-miR-6875-5p	Luciferase reporter assayWestern blottingqRT-PCR	33899508
MIRT499838	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT499835	hsa-miR-3976	PAR-CLIP	20371350
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	20371350
MIRT499834	hsa-miR-1208	PAR-CLIP	20371350
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	20371350
MIRT499830	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	20371350
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	20371350
MIRT499826	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT499825	hsa-miR-1303	PAR-CLIP	20371350
MIRT499838	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT499835	hsa-miR-3976	PAR-CLIP	20371350
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	20371350
MIRT499834	hsa-miR-1208	PAR-CLIP	20371350
MIRT499833	hsa-miR-1915-3p	PAR-CLIP	20371350
MIRT499831	hsa-miR-6764-5p	PAR-CLIP	20371350
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	20371350
MIRT499830	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	20371350
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	20371350
MIRT499826	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT499825	hsa-miR-1303	PAR-CLIP	20371350
MIRT569930	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT569929	hsa-miR-1912	PAR-CLIP	20371350
MIRT569928	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT569927	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT569926	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT569925	hsa-miR-3174	PAR-CLIP	20371350
MIRT569924	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT569923	hsa-miR-759	PAR-CLIP	20371350
MIRT569922	hsa-miR-6852-5p	PAR-CLIP	20371350
MIRT569921	hsa-miR-4667-5p	PAR-CLIP	20371350
MIRT569919	hsa-miR-4700-5p	PAR-CLIP	20371350
MIRT569920	hsa-miR-8089	PAR-CLIP	20371350
MIRT569918	hsa-miR-765	PAR-CLIP	20371350
MIRT569917	hsa-miR-3612	PAR-CLIP	20371350
MIRT569916	hsa-miR-650	PAR-CLIP	20371350
MIRT569915	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569914	hsa-miR-3175	PAR-CLIP	20371350
MIRT569913	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569912	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569911	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569910	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569909	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569908	hsa-miR-7107-5p	PAR-CLIP	20371350
MIRT499838	hsa-miR-483-5p	PAR-CLIP	21572407
MIRT499837	hsa-miR-1182	PAR-CLIP	21572407
MIRT499835	hsa-miR-3976	PAR-CLIP	21572407
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	21572407
MIRT499834	hsa-miR-1208	PAR-CLIP	21572407
MIRT499833	hsa-miR-1915-3p	PAR-CLIP	21572407
MIRT499831	hsa-miR-6764-5p	PAR-CLIP	21572407
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT499830	hsa-miR-367-5p	PAR-CLIP	21572407
MIRT499829	hsa-miR-193a-5p	PAR-CLIP	21572407
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	21572407
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	21572407
MIRT499826	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT499825	hsa-miR-1303	PAR-CLIP	21572407
MIRT499838	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT499837	hsa-miR-1182	PAR-CLIP	23446348
MIRT499835	hsa-miR-3976	PAR-CLIP	23446348
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT499834	hsa-miR-1208	PAR-CLIP	23446348
MIRT499833	hsa-miR-1915-3p	PAR-CLIP	23446348
MIRT499831	hsa-miR-6764-5p	PAR-CLIP	23446348
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	23446348
MIRT499830	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT499829	hsa-miR-193a-5p	PAR-CLIP	23446348
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT499826	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT499825	hsa-miR-1303	PAR-CLIP	23446348
MIRT499838	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT499835	hsa-miR-3976	PAR-CLIP	23446348
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT499834	hsa-miR-1208	PAR-CLIP	23446348
MIRT499830	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT499826	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT499825	hsa-miR-1303	PAR-CLIP	23446348
MIRT499838	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT499835	hsa-miR-3976	PAR-CLIP	23446348
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT499834	hsa-miR-1208	PAR-CLIP	23446348
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	23446348
MIRT499830	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT499826	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT499825	hsa-miR-1303	PAR-CLIP	23446348
MIRT499838	hsa-miR-483-5p	PAR-CLIP	24398324
MIRT499837	hsa-miR-1182	PAR-CLIP	24398324
MIRT499835	hsa-miR-3976	PAR-CLIP	24398324
MIRT499836	hsa-miR-6760-3p	PAR-CLIP	24398324
MIRT499834	hsa-miR-1208	PAR-CLIP	24398324
MIRT499833	hsa-miR-1915-3p	PAR-CLIP	24398324
MIRT499831	hsa-miR-6764-5p	PAR-CLIP	24398324
MIRT499832	hsa-miR-1304-3p	PAR-CLIP	24398324
MIRT499830	hsa-miR-367-5p	PAR-CLIP	24398324
MIRT499829	hsa-miR-193a-5p	PAR-CLIP	24398324
MIRT499827	hsa-miR-6501-5p	PAR-CLIP	24398324
MIRT499828	hsa-miR-4423-5p	PAR-CLIP	24398324
MIRT499826	hsa-miR-744-3p	PAR-CLIP	24398324
MIRT499825	hsa-miR-1303	PAR-CLIP	24398324
MIRT459660	hsa-miR-6882-5p	PAR-CLIP	23592263
MIRT459659	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT459658	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT459656	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT459657	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT459655	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT459654	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT459652	hsa-miR-6761-5p	PAR-CLIP	23592263
MIRT459653	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT459650	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT459651	hsa-miR-4721	PAR-CLIP	23592263
MIRT459649	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT459648	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT459647	hsa-miR-4656	PAR-CLIP	23592263
MIRT459646	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT459645	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT1218578	hsa-miR-148a	CLIP-seq
MIRT1218579	hsa-miR-148b	CLIP-seq
MIRT1218580	hsa-miR-152	CLIP-seq
MIRT1218581	hsa-miR-1972	CLIP-seq
MIRT1218582	hsa-miR-3165	CLIP-seq
MIRT1218583	hsa-miR-3189-3p	CLIP-seq
MIRT1218584	hsa-miR-4329	CLIP-seq
MIRT1218585	hsa-miR-4722-3p	CLIP-seq
MIRT1218586	hsa-miR-4755-3p	CLIP-seq
MIRT1218587	hsa-miR-501-3p	CLIP-seq
MIRT1218588	hsa-miR-502-3p	CLIP-seq
MIRT1218589	hsa-miR-767-5p	CLIP-seq
MIRT1218581	hsa-miR-1972	CLIP-seq
MIRT2291632	hsa-miR-1184	CLIP-seq
MIRT2291633	hsa-miR-2355-3p	CLIP-seq
MIRT2291634	hsa-miR-3065-3p	CLIP-seq
MIRT2291635	hsa-miR-3162-3p	CLIP-seq
MIRT2291636	hsa-miR-4646-3p	CLIP-seq
MIRT2589384	hsa-miR-124	CLIP-seq
MIRT2589385	hsa-miR-506	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HNF4A	Activation	21123766
SREBF1	Activation	17921436
SREBF2	Activation	17448444;17921436;21123766;22288532

Show/Hide all (90)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS	12552133
GO:0001889	Process	Liver development	IEA
GO:0001889	Process	Liver development	ISS	12552133
GO:0001920	Process	Negative regulation of receptor recycling	IDA	17452316, 22848640
GO:0002091	Process	Negative regulation of receptor internalization	IDA	18799458
GO:0002092	Process	Positive regulation of receptor internalization	IDA	17328821
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	12552133
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	17461796, 18250299, 18753623, 18799458, 22081141, 22493497, 22580899, 22848640, 25613181
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	12552133, 16912035, 17080197
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	22580899
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IDA	17461796, 18039658
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	17461796
GO:0005770	Component	Late endosome	IDA	17461796, 18039658
GO:0005783	Component	Endoplasmic reticulum	IDA	17461796
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA	17461796
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IDA	18799458
GO:0006508	Process	Proteolysis	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007041	Process	Lysosomal transport	IDA	17452316
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009267	Process	Cellular response to starvation	ISS	16407292
GO:0009986	Component	Cell surface	IDA	17461796
GO:0009986	Component	Cell surface	IEA
GO:0010989	Process	Negative regulation of low-density lipoprotein particle clearance	IDA	17328821, 22848640
GO:0016485	Process	Protein processing	IEA
GO:0016540	Process	Protein autoprocessing	IDA	14622975
GO:0016540	Process	Protein autoprocessing	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019871	Function	Sodium channel inhibitor activity	IDA	22493497
GO:0022008	Process	Neurogenesis	IEA
GO:0022008	Process	Neurogenesis	ISS	12552133
GO:0030134	Component	COPII-coated ER to Golgi transport vesicle	IEA
GO:0030169	Function	Low-density lipoprotein particle binding	IEA
GO:0030169	Function	Low-density lipoprotein particle binding	ISS
GO:0030182	Process	Neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	ISS	12552133
GO:0030547	Function	Signaling receptor inhibitor activity	IDA	22848640
GO:0031232	Component	Extrinsic component of external side of plasma membrane	IC	17328821
GO:0032799	Process	Low-density lipoprotein receptor particle metabolic process	IEA
GO:0032802	Process	Low-density lipoprotein particle receptor catabolic process	IDA	16912035, 18197702
GO:0032803	Process	Regulation of low-density lipoprotein particle receptor catabolic process	IEA
GO:0032805	Process	Positive regulation of low-density lipoprotein particle receptor catabolic process	IDA	22081141, 22848640
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS	12552133
GO:0034185	Function	Apolipoprotein binding	IEA
GO:0034185	Function	Apolipoprotein binding	ISS
GO:0034189	Function	Very-low-density lipoprotein particle binding	IEA
GO:0034189	Function	Very-low-density lipoprotein particle binding	ISS
GO:0034190	Function	Apolipoprotein receptor binding	IDA	18039658
GO:0036020	Component	Endolysosome membrane	TAS
GO:0042157	Process	Lipoprotein metabolic process	IEA
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	IMP	17170371
GO:0043523	Process	Regulation of neuron apoptotic process	IEA
GO:0043523	Process	Regulation of neuron apoptotic process	ISS
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IMP	17051583
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18039658
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IDA	17080197
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IEA
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IPI	17452316, 22081141, 22848640
GO:0070326	Function	Very-low-density lipoprotein particle receptor binding	IDA	18039658
GO:1903783	Process	Negative regulation of sodium ion import across plasma membrane	IDA	22493497
GO:1905601	Process	Negative regulation of receptor-mediated endocytosis involved in cholesterol transport	IDA	22848640
GO:1990666	Component	PCSK9-LDLR complex	IDA	22081141, 22848640
GO:1990667	Component	PCSK9-AnxA2 complex	IDA	22848640
GO:1990667	Component	PCSK9-AnxA2 complex	IPI	24808179

MIM	HGNC	e!Ensembl
607786	20001	ENSG00000169174

Q8NBP7

Protein name

Proprotein convertase subtilisin/kexin type 9 (EC 3.4.21.-) (Neural apoptosis-regulated convertase 1) (NARC-1) (Proprotein convertase 9) (PC9) (Subtilisin/kexin-like protease PC9)

Protein function

Crucial player in the regulation of plasma cholesterol homeostasis. Binds to low-density lipid receptor family members: low density lipoprotein receptor (LDLR), very low density lipoprotein receptor (VLDLR), apolipoprotein E receptor (LRP1/APOER

PDB

2P4E , 2PMW , 2QTW , 2W2M , 2W2N , 2W2O , 2W2P , 2W2Q , 2XTJ , 3BPS , 3GCW , 3GCX , 3H42 , 3M0C , 3P5B , 3P5C , 3SQO , 4K8R , 4NE9 , 4NMX , 4OV6 , 5OCA , 5VL7 , 5VLA , 5VLH , 5VLK , 5VLL , 5VLP , 6E4Y , 6E4Z , 6MV5 , 6OLZ , 6OM0 , 6OM7 , 6U26 , 6U2F , 6U2N , 6U2P , 6U36 , 6U38 , 6U3I , 6U3X , 7ANQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05922	Inhibitor_I9	77 → 152	Peptidase inhibitor I9	Domain
PF00082	Peptidase_S8	177 → 436	Subtilase family	Domain
PF18459	PCSK9_C1	449 → 531	Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain	Domain
PF18464	PCSK9_C2	535 → 600	Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain	Domain
PF18463	PCSK9_C3	602 → 682	Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in neuro-epithelioma, colon carcinoma, hepatic and pancreatic cell lines, and in Schwann cells.

Sequence

MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGT
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLP
GFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLV
EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG
VAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA
CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD
LFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA
KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPD
EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAP
PAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC
CHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRD
VSTTGSTSEGAVTAVAICCRSRHLAQASQELQ

Sequence length

692

Interactions

View interactions

	KEGG		Reactome
	Cholesterol metabolism		Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) VLDLR internalisation and degradation Post-translational protein phosphorylation LDL clearance

2585

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cardiovascular phenotype	Likely pathogenic; Pathogenic	rs137852912, rs794728683, rs564427867	RCV004018541 RCV005384666 RCV005384688 RCV002374503
Familial hypercholesterolemia	Likely pathogenic; Pathogenic	rs28942111, rs137852912, rs794728683, rs564427867	RCV005402793 RCV005862692 RCV001526127 RCV000775016
Homozygous familial hypercholesterolemia	Likely pathogenic; Pathogenic	rs137852912, rs794728683, rs564427867	RCV004017221 RCV004017461 RCV000825628
Hypercholesterolemia, autosomal dominant, 3	Likely pathogenic; Pathogenic	rs1644681544, rs2100343401, rs28942111, rs28942112, rs137852912, rs794728683, rs564427867	RCV001313945 RCV001450047 RCV000003007 RCV000003008 RCV000003009 RCV000412537 RCV002866861 RCV001859495 RCV000778097
Hypercholesterolemia, familial, 1	Likely pathogenic; Pathogenic	rs28942111, rs137852912, rs794728683, rs564427867, rs371488778, rs1553137543, rs1372204035, rs1553135930, rs1057519691, rs1553137693, rs1553137699, rs886046435	RCV000505185 RCV000505195 RCV000505198 RCV000256334 RCV000331053 RCV000497058 RCV000505257 RCV000508901 RCV000508728 RCV000508743 RCV000508921 RCV000508856 RCV000508785
PCSK9-related disorder	Likely pathogenic; Pathogenic	rs564427867	RCV004734956

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Conflicting classifications of pathogenicity	rs41297883	RCV005895400
Familial cancer of breast	Uncertain significance	rs765335983	RCV005897373
Familial hypobetalipoproteinemia	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	rs886046432, rs757944328, rs886046438, rs886046440, rs886046442, rs886046445, rs886046449, rs72646537, rs886046428, rs886046431, rs375892354, rs72646510, rs886046441, rs886046443, rs563024336 View all (16 more)	RCV000403986 RCV000377324 RCV000391291 RCV000381722 RCV000340897 RCV000306904 RCV000343950 RCV000274088 RCV000372548 RCV000341084 RCV000311424 RCV000295282 RCV000292223 RCV000405539 RCV000316238 RCV000262336 RCV000377009 RCV000382948 RCV000309461 RCV000342130 RCV000407470 RCV000385977 RCV000317231 RCV000360414 RCV000329993 RCV000281454 RCV000284650 RCV000356197 RCV000267410 RCV000280163 RCV000282767 RCV000288472
Hepatocellular carcinoma	Benign	rs2495482	RCV005894338
High myopia	Uncertain significance	rs1557500768, rs1557500771	RCV000785732 RCV000785733
Hypobetalipoproteinemia	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	rs11591147, rs540796, rs141502002, rs562556, rs374603772, rs41297883, rs28385701, rs2495482, rs11800243, rs28385710, rs2495477, rs509504, rs28362263, rs72658888, rs28362201 View all (85 more)	RCV001099060 RCV000273530 RCV001095907 RCV000330942 RCV001097684 RCV000361138 RCV000355523 RCV000284564 RCV000405994 RCV000321631 RCV000273052 RCV000337265 RCV000309633 RCV001100779 RCV000277576 RCV000260499 RCV001099242 RCV001095906 RCV000262809 RCV000366499 RCV000369827 RCV000403056 RCV000347560 RCV000310176 RCV000370786 RCV000335192 RCV000317305 RCV001101657 RCV001096218 RCV000308886 RCV000315251 RCV001097486 RCV000332054 RCV001101460 RCV000391287 RCV000313874 RCV000321169 RCV000276055 RCV000358608 RCV001099572 RCV001101552 RCV001097965 RCV000285770 RCV000297926 RCV000338615 RCV001097783 RCV000304492 RCV000288945 RCV000301062 RCV000386456 RCV000337130 RCV001101340 RCV001101139 RCV001097683 RCV001099350 RCV001099461 RCV001099463 RCV001100777 RCV001100867 RCV001096000 RCV000309852 RCV000373308 RCV000364880 RCV000289127 RCV000300438 RCV001097398 RCV001099139 RCV001099240 RCV001096001 RCV001099059 RCV001101244 RCV001097485 RCV001101465 RCV001095998 RCV001097585 RCV001099351 RCV001099462 RCV001097782 RCV001097396 RCV001097586 RCV001095904 RCV001101039 RCV001097309 RCV001097311 RCV001100869 RCV001101141 RCV001099142 RCV001101242 RCV001097588 RCV001101338 RCV001097685 RCV001101462 RCV001101464 RCV001096003 RCV001101553 RCV001096120 RCV001097868 RCV001097870 RCV001101655 RCV001096219 RCV001096222 RCV001097966
Hypocholesterolemia	Conflicting classifications of pathogenicity; Benign; Likely benign; Uncertain significance	rs28362286, rs11591147, rs1272703401, rs745633457	RCV000508694 RCV000508774 RCV000508715 RCV000508845
Low density lipoprotein cholesterol level quantitative trait locus 1	Conflicting classifications of pathogenicity; Benign; Likely benign	rs67608943, rs28362286, rs11591147, rs587776545	RCV000003010 RCV000003011 RCV000003012 RCV000003014
Lung cancer	Conflicting classifications of pathogenicity	rs41297883	RCV005895401
See cases	Conflicting classifications of pathogenicity	rs374603772	RCV004584369
Short fetal femur length	Conflicting classifications of pathogenicity; Benign	rs148195424, rs585131, rs2483205	RCV002463441 RCV002463442 RCV002463432

Show/Hide Text Mining Associations (151)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abetalipoproteinemia	Associate	27179706
Acute Coronary Syndrome	Associate	37058054
Acute Disease	Stimulate	25180781
Adenocarcinoma of Lung	Associate	33153169, 35635202, 37189138
Alcoholism	Stimulate	30933362
Alzheimer Disease	Associate	28438747, 36293049
Alzheimer Disease	Stimulate	31437157
Aneurysm	Inhibit	30210081
Angina Stable	Associate	31672148
Antiphospholipid Syndrome	Associate	26820623
Aortic Aneurysm Abdominal	Inhibit	30210081
Aortic Aneurysm Abdominal	Associate	30275531, 33166319, 37055467, 40008516
Aortic Valve Stenosis	Associate	27152866
Arcus Senilis	Associate	37185657
Arteriolosclerosis	Associate	24135527
Arthritis Rheumatoid	Associate	34928185
Asthma	Associate	38198221
Atherosclerosis	Associate	17940607, 25210046, 29807195, 31707849, 31802881, 31805108, 32208829, 32565719, 33166319, 33533259, 34336112, 34369165, 34884442, 34928185, 35289693, 36012389, 36982171, 38198221 View all (3 more)
Atherosclerosis	Inhibit	19001363, 28886926, 36722156
Atherosclerosis	Stimulate	25064003
Atrial Fibrillation	Inhibit	38531334
Autoimmune Diseases	Associate	34928185
Bone Diseases Metabolic	Associate	32929056
Calcinosis	Associate	40239750
Carcinoma Hepatocellular	Inhibit	26674961
Carcinoma Hepatocellular	Associate	28178673, 37151886
Carcinoma Ovarian Epithelial	Associate	32068819
Cardiovascular Diseases	Associate	22575316, 26374825, 27856457, 27959767, 29997226, 30210081, 30779729, 31253441, 31437157, 32084179, 32846800, 33642439, 35501368, 35921096, 36012389 View all (4 more)
Cardiovascular Diseases	Inhibit	28330911
Cardiovascular Diseases	Stimulate	30617148
Carotid Stenosis	Associate	32208829
Carotid Stenosis	Inhibit	38198221
Cerebral Infarction	Associate	17940607, 29997226, 31250580, 31664920, 36244797, 38198221
Cerebral Infarction	Inhibit	33166319
Cerebral Small Vessel Diseases	Associate	17940607
Cognition Disorders	Associate	31437157, 33166319, 36285785
Cognitive Dysfunction	Associate	29146683
Colorectal Neoplasms	Associate	36003387, 36242053
Coronary Aneurysm	Associate	20031607, 30555118, 31672148
Coronary Artery Disease	Associate	15893176, 18547436, 20031607, 20699424, 24243630, 25180781, 26036859, 26266351, 26374825, 26934567, 26946290, 27049268, 27135400, 27540175, 28167353 View all (15 more)
Coronary Artery Disease	Inhibit	29986042
Coronary Artery Disease	Stimulate	39445733
Coronary Artery Disease Autosomal Dominant 1	Associate	22216278
Coronary Disease	Associate	15893176, 16554528, 16909389, 17142622, 17940607, 18262190, 18300938, 19001363, 19351729, 20172854, 22152955, 23054246, 23300213, 27049268, 27280970 View all (5 more)
Coronary Disease	Inhibit	23642322, 24094767
Coronary Stenosis	Associate	34075144
COVID 19	Associate	34895256
Cryoglobulinemia	Stimulate	35677050
Cushing's symphalangism	Stimulate	27049268
Deafness Autosomal Recessive 15	Associate	33886544
Death	Associate	36285785
Dementia	Associate	28438747, 30933362, 33166319, 36285785
Dementia Vascular	Associate	28438747
Depressive Disorder	Stimulate	29986042
Depressive Disorder Major	Associate	36580462
Diabetes Gestational	Stimulate	35498417
Diabetes Gestational	Associate	35721735
Diabetes Mellitus	Associate	27959767, 30779729, 31672148, 35660019, 36142332
Diabetes Mellitus Type 1	Associate	27908689
Diabetes Mellitus Type 2	Associate	27908689, 29997226, 31664920, 33302966, 35733117, 40071808
Diabetic Nephropathies	Associate	40225015
Diabetic Neuropathies	Stimulate	40225015
Disease	Associate	28777095
Drug Related Side Effects and Adverse Reactions	Associate	36285785
Dyslipidemias	Associate	21497351, 23386099, 29724976, 29807195, 31480784, 32929056, 37582372
Embolism and Thrombosis	Associate	35501368
Epileptic Syndromes	Associate	17142622, 23054246, 23669246, 24987033, 29802317, 31100618, 31746944, 33955087, 34462766, 36499307, 36834740
Fatty Liver	Associate	34876018, 40250425
Fetal Growth Retardation	Associate	27842594
Fibrosis	Associate	26674961
Glioma	Associate	26045785
Graves Ophthalmopathy	Associate	33488522
Heart Diseases	Associate	29259136
Heart Failure	Associate	31509211
Hepatitis C	Associate	29120899
HIV Infections	Associate	29120899, 32496664
Homozygous Familial Hypercholesterolemia	Stimulate	23537802
Homozygous Familial Hypercholesterolemia	Associate	29284604, 33599434, 37850379, 38545781
Hypercholesterolemia	Associate	15893176, 16875509, 16912035, 18266662, 18354137, 19224862, 20172854, 22875854, 23642322, 23951290, 24632287, 26318398, 29185237, 29997226, 30266833 View all (9 more)
Hypercholesterolemia	Stimulate	28199412
Hyperlipidemias	Associate	29997226
Hyperlipidemias	Inhibit	30280628
Hyperlipoproteinemia Type II	Associate	10205269, 15893176, 16465619, 17964958, 18033751, 18245819, 18266662, 18354137, 18547436, 19001363, 19224862, 19571328, 19768174, 20571503, 20809525 View all (87 more)
Hyperlipoproteinemia Type II	Stimulate	19571328, 23537802, 26036859, 28199412
Hyperlipoproteinemia Type III	Associate	22764087
Hypertension	Associate	35501368
Hypertriglyceridemia	Associate	31480784
Hypobetalipoproteinemia Familial 1	Inhibit	28633452
Hypobetalipoproteinemia Familial 2	Associate	28633452
Hypobetalipoproteinemias	Associate	21502677, 27179706, 31653860, 32173689, 33207932, 37302939
Infections	Associate	31509211, 40522254
Inflammation	Inhibit	28100270
Inflammation	Associate	32565719, 33488522, 33576442, 34336112, 34864314, 34928185, 35733117, 36003387, 36012389, 38272483, 40522254
Insulin Resistance	Associate	29946054, 31672148, 33302966
Intervertebral Disc Degeneration	Associate	39358768
Intracranial Arteriosclerosis	Associate	17940607, 36244797
Job Syndrome	Associate	16912035
Kidney Neoplasms	Inhibit	39379957
Liver Cirrhosis	Inhibit	33461570
Low Back Pain	Associate	39358768
Lung Neoplasms	Associate	23409034, 9510477
Lupus Erythematosus Systemic	Associate	34928185
Mental Disorders	Associate	35501368
Mesenteric Vascular Occlusion	Associate	29997226
Metabolic Diseases	Associate	27488210
Metabolic Syndrome	Associate	27488210, 27540175, 31672148, 34864314
Mitochondrial Diseases	Stimulate	33576442
Mood Disorders	Associate	35501368, 36285785, 36580462
Muscular Dystrophy Congenital with Rapid Progression	Associate	39379957
Myocardial Infarction	Associate	20699424, 22714699, 28330911, 29802317, 30971288, 31664920, 31969932, 33533259, 33642439, 40076866
Myocardial Infarction	Stimulate	25180781
Myocardial Ischemia	Associate	25412415, 29396305, 37940228
Neoplasm Metastasis	Inhibit	36242053
Neoplasms	Associate	23409034, 36003387, 36076548, 36242053, 38275613
Neoplasms Adipose Tissue	Associate	35501368
Neural Tube Defects	Associate	29185237
Neurocognitive Disorders	Associate	29146683
Neurotoxicity Syndromes	Stimulate	36293049
Non alcoholic Fatty Liver Disease	Associate	32698306, 33454241
Non alcoholic Fatty Liver Disease	Inhibit	32698306
Obesity	Associate	23039238, 31672148, 34075144, 38272483
Oculopalatocerebral Syndrome	Associate	33886544
Ovarian Neoplasms	Associate	32068819
Overweight	Associate	23039238, 28228332, 38272483
Pain	Stimulate	36920122
Parkinson Disease	Associate	28438747
Peripheral Arterial Disease	Associate	18436227, 33166319, 39304430
Platelet Glycoprotein IV Deficiency	Associate	33642439
Pneumonia Lipid	Associate	23642322
Polycythemia Vera	Associate	32606442
Prediabetic State	Associate	33302966
Pressure Ulcer	Associate	22606049
Prostatic Neoplasms	Associate	36595504
Pseudoxanthoma Elasticum	Associate	25064003
Pulmonary Disease Chronic Obstructive	Associate	38198221, 40522254
Renal Insufficiency Chronic	Associate	34336112
Respiratory System Abnormalities	Associate	34864314
Respiratory Tract Diseases	Associate	38198221
Respiratory Tract Infections	Associate	38198221
Sciatica	Associate	39358768
Sepsis	Associate	31509211
Severe Acute Respiratory Syndrome	Associate	35501368
Sleep Initiation and Maintenance Disorders	Associate	29986042, 34994160
Spinal Dysraphism	Associate	29185237
Stomach Neoplasms	Associate	23161554, 38275613
Stroke	Associate	17940607, 25266949, 27280970, 29146683
Thrombosis	Associate	26820623
Triglyceride Storage Disease Type I	Associate	27853278
Vascular Diseases	Associate	18262190, 34336112, 34864314, 38198221
Virus Diseases	Associate	35660019
Weight Loss	Associate	27908689

PCSK9 (proprotein convertase subtilisin/kexin type 9)