Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	255626
Gene name Gene Name - the full gene name approved by the HGNC.	H2B clustered histone 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	H2BC1
Synonyms (NCBI Gene) Gene synonyms aliases	H2BFU, HIST1H2BA, STBP, TH2B, TSH2B, TSH2B.1, bA317E16.3, hTSH2B
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p22.2
Summary Summary of gene provided in NCBI Entrez Gene.	Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0000786	Component	Nucleosome	IDA	24699735
GO:0000786	Component	Nucleosome	ISS
GO:0003674	Function	Molecular_function	ND
GO:0003677	Function	DNA binding	IBA	21873635
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0006334	Process	Nucleosome assembly	IBA	21873635
GO:0006334	Process	Nucleosome assembly	IDA	24699735
GO:0006334	Process	Nucleosome assembly	ISS
GO:0006337	Process	Nucleosome disassembly	ISS
GO:0006954	Process	Inflammatory response	IEA
GO:0016567	Process	Protein ubiquitination	TAS
GO:0019897	Component	Extrinsic component of plasma membrane	IEA
GO:0031639	Process	Plasminogen activation	IEA
GO:0035093	Process	Spermatogenesis, exchange of chromosomal proteins	ISS
GO:0042393	Function	Histone binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0051099	Process	Positive regulation of binding	IEA
GO:0071674	Process	Mononuclear cell migration	IEA

MIM	HGNC	e!Ensembl
609904	18730	ENSG00000146047

Protein

UniProt ID

Q96A08

Protein name

Histone H2B type 1-A (Histone H2B, testis) (TSH2B.1) (hTSH2B) (Testis-specific histone H2B)

Protein function

Variant histone specifically required to direct the transformation of dissociating nucleosomes to protamine in male germ cells (By similarity). Entirely replaces classical histone H2B prior nucleosome to protamine transition and probably acts as

PDB

3WKJ , 5GSU , 5GT3 , 6BIY , 8VLR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00125	Histone	2 → 103	Core histone H2A/H2B/H3/H4	Domain

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in testis, and the corresponding protein is also present in mature sperm (at protein level). Also found in some fat cells. {ECO:0000269|PubMed:12213818, ECO:0000269|PubMed:21249133}.

Sequence

MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK

Sequence length

127

Interactions

View interactions

	KEGG		Reactome
	Neutrophil extracellular trap formation Alcoholism Viral carcinogenesis Systemic lupus erythematosus		Recognition and association of DNA glycosylase with site containing an affected purine Cleavage of the damaged purine Packaging Of Telomere Ends Formation of the beta-catenin:TCF transactivating complex PRC2 methylates histones and DNA Condensation of Prophase Chromosomes Oxidative Stress Induced Senescence Senescence-Associated Secretory Phenotype (SASP) DNA Damage/Telomere Stress Induced Senescence HDACs deacetylate histones HATs acetylate histones SIRT1 negatively regulates rRNA expression NoRC negatively regulates rRNA expression B-WICH complex positively regulates rRNA expression Transcriptional regulation by small RNAs Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 Ub-specific processing proteases Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Nonhomologous End-Joining (NHEJ) Processing of DNA double-strand break ends Deposition of new CENPA-containing nucleosomes at the centromere G2/M DNA damage checkpoint RNA Polymerase I Promoter Opening RNA Polymerase I Promoter Escape E3 ubiquitin ligases ubiquitinate target proteins RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function Estrogen-dependent gene expression HCMV Early Events HCMV Late Events Amyloid fiber formation

H2BC1 (H2B clustered histone 1)