Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
255520
Gene name Gene Name - the full gene name approved by the HGNC.
ELMO domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ELMOD2
Synonyms (NCBI Gene) Gene synonyms aliases
9830169G11Rik
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis. [provided by
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005121 hsa-miR-30a-5p pSILAC 18668040
MIRT023938 hsa-miR-1-3p Proteomics 18668040
MIRT005121 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT052229 hsa-let-7b-5p CLASH 23622248
MIRT635534 hsa-miR-4668-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005096 Function GTPase activator activity IBA 21873635
GO:0005096 Function GTPase activator activity IDA 17452337
GO:0016020 Component Membrane HDA 19946888
GO:0043547 Process Positive regulation of GTPase activity IEA
GO:0050688 Process Regulation of defense response to virus IDA 17452337
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610196 28111 ENSG00000179387
Protein
UniProt ID Q8IZ81
Protein name ELMO domain-containing protein 2
Protein function Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family. Regulates IFN-related antiviral responses. {ECO:0000269|PubMed:17452337, ECO:0000269
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04727 ELMO_CED12 111 271 ELMO/CED-12 family Family
Tissue specificity TISSUE SPECIFICITY: Alveolar cells (morphologically type II cells) and alveolar macrophages (at protein level). Expressed in brain, colon, heart, kidney, liver, lung, muscle, placenta, small intestine, spleen, stomach and testis. In lung it is expressed i
Sequence
MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQ
KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPY
DSDNLQHEELLMKLWNLLMPTKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYF
SENYTSEAHQILSRSNHPKLGYSYAIVGINLTEMAYSLLKSEALKFHLYNLVPGIPTMEH
FHQFYCYLVYEFDKFWFEEEPESIMYFNLYR
EKFHEKIKGLLLDCNVALTLKV
Sequence length 293
Interactions View interactions