Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	255426
Gene name	RasGEF domain family member 1C
Gene symbol	RASGEF1C
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q35.3

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018443	hsa-miR-335-5p	Microarray	18185580
MIRT1292267	hsa-miR-1972	CLIP-seq
MIRT1292268	hsa-miR-214	CLIP-seq
MIRT1292269	hsa-miR-2467-3p	CLIP-seq
MIRT1292270	hsa-miR-3158-5p	CLIP-seq
MIRT1292271	hsa-miR-3180	CLIP-seq
MIRT1292272	hsa-miR-3180-3p	CLIP-seq
MIRT1292273	hsa-miR-3196	CLIP-seq
MIRT1292274	hsa-miR-3619-5p	CLIP-seq
MIRT1292275	hsa-miR-3678-3p	CLIP-seq
MIRT1292276	hsa-miR-4283	CLIP-seq
MIRT1292277	hsa-miR-4488	CLIP-seq
MIRT1292278	hsa-miR-4489	CLIP-seq
MIRT1292279	hsa-miR-4690-5p	CLIP-seq
MIRT1292280	hsa-miR-4697-5p	CLIP-seq
MIRT1292281	hsa-miR-619	CLIP-seq
MIRT1292282	hsa-miR-761	CLIP-seq
MIRT1292268	hsa-miR-214	CLIP-seq
MIRT2086855	hsa-miR-3151	CLIP-seq
MIRT1292271	hsa-miR-3180	CLIP-seq
MIRT1292272	hsa-miR-3180-3p	CLIP-seq
MIRT1292273	hsa-miR-3196	CLIP-seq
MIRT1292274	hsa-miR-3619-5p	CLIP-seq
MIRT2086856	hsa-miR-4318	CLIP-seq
MIRT2086857	hsa-miR-4447	CLIP-seq
MIRT2086858	hsa-miR-4472	CLIP-seq
MIRT1292277	hsa-miR-4488	CLIP-seq
MIRT1292280	hsa-miR-4697-5p	CLIP-seq
MIRT2086859	hsa-miR-491-5p	CLIP-seq
MIRT1292282	hsa-miR-761	CLIP-seq
MIRT2086855	hsa-miR-3151	CLIP-seq
MIRT1292271	hsa-miR-3180	CLIP-seq
MIRT1292272	hsa-miR-3180-3p	CLIP-seq
MIRT1292273	hsa-miR-3196	CLIP-seq
MIRT2311791	hsa-miR-4252	CLIP-seq
MIRT2086856	hsa-miR-4318	CLIP-seq
MIRT2086857	hsa-miR-4447	CLIP-seq
MIRT2086858	hsa-miR-4472	CLIP-seq
MIRT1292277	hsa-miR-4488	CLIP-seq
MIRT2311792	hsa-miR-4492	CLIP-seq
MIRT2311793	hsa-miR-4498	CLIP-seq
MIRT1292280	hsa-miR-4697-5p	CLIP-seq
MIRT2086859	hsa-miR-491-5p	CLIP-seq
MIRT2311794	hsa-miR-762	CLIP-seq
MIRT2086855	hsa-miR-3151	CLIP-seq
MIRT1292271	hsa-miR-3180	CLIP-seq
MIRT1292272	hsa-miR-3180-3p	CLIP-seq
MIRT1292273	hsa-miR-3196	CLIP-seq
MIRT2311791	hsa-miR-4252	CLIP-seq
MIRT2086856	hsa-miR-4318	CLIP-seq
MIRT2086857	hsa-miR-4447	CLIP-seq
MIRT2086858	hsa-miR-4472	CLIP-seq
MIRT1292277	hsa-miR-4488	CLIP-seq
MIRT1292280	hsa-miR-4697-5p	CLIP-seq
MIRT2086859	hsa-miR-491-5p	CLIP-seq
MIRT2608209	hsa-miR-370	CLIP-seq
MIRT2608210	hsa-miR-4474-3p	CLIP-seq
MIRT2608211	hsa-miR-4763-5p	CLIP-seq
MIRT2608209	hsa-miR-370	CLIP-seq
MIRT2608210	hsa-miR-4474-3p	CLIP-seq
MIRT2608211	hsa-miR-4763-5p	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8N431

Protein name

Ras-GEF domain-containing family member 1C

Protein function

Guanine nucleotide exchange factor (GEF).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00618	RasGEF_N	37 → 138	RasGEF N-terminal motif	Domain
PF00617	RasGEF	203 → 396	RasGEF domain	Family

Sequence

MPQTLSASDMVTPGSLSPPPTEPTDGEQAGQPLLDGAPSSASLETLIQHLVPTADYYPEK
AYIFTFLLSSRLFIEPRELLARVCHLCIEQQQLDKPVLDKARVRKFGPKLLQLLAEWTET
FPRDFQEESTIGHLKDVVGRIAPCDEAYRKRMHQLLQALHQKLAALRQGPEGLVGADKPI
SYRTKPPASIHRELLGVCSDPYTLAQQLTHVELERLRHIGPEEFVQAFVNKDPLASTKPC
FSDKTSNLEAYVKWFNRLCYLVATEICMPAKKKQRAQVIEFFIDVARECFNIGNFNSLMA
IISGMNMSPVSRLKKTWAKVRTAKFFILEHQMDPTGNFCNYRTALRGAAHRSLTAHSSRE
KIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFLELAKQVGEFITWKQVECPFEQDAS
ITHYLYTAPIFSEDGLYLASYESESPENQTEKERWKALRSSILGKT

Sequence length

466

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	34584172	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Associate	34572079	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Associate	34584172	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroinflammatory Diseases	Associate	33069246	★★★★★ ★☆☆☆☆ Found in Text Mining only

RASGEF1C (RasGEF domain family member 1C)